>Seq1

MKTAALAPLFFLPSALATTVYLAGDSTMAKNGGGSGTNGWGEYLASYLSATVVNDAVAGR

SARSYTREGRFENIADVVTAGDYVIVEFGHNDGGSLSTDNGRTDCSGTGAEVCYSVYDGV

NETILTFPAYLENAAKLFTAKGAKVILSSQTPNNPWETGTFVNSPTRFVEYAELAAEVAG

VEYVDHWSYVDSIYETLGNATVNSYFPIDHTHTSPAGAEVVAEAFLKAVVCTGTSLKSVL

TTTSFEGTCL

 

  1. Is Seq1 a secreted protein ?
    1. Is it a reliable prediction ?

 

 

  1. Does it have a propeptide ?
    1. Is it a reliable prediction ?

 

 

  1. What is the range of the mature protein
    1. Start:
    2. End:

 

 

  1. What is the consequence/reason of a sequence having a
    1. Signal peptide ?
    2. ProPeptide ?

 

 

  1. Glycosylated residues (Find NetNglyc & NetOglyc):
    1. N-glycosylated amino acids ?
    2. O-glycosylated amino acids ?

 

 

  1. Draw a schematic representation of a neural network with two Input neurons, two hidden neurons and 1 output neuron.

 

I1   =  5.0

I2   = -3.0

W1,1 =  0.3

W1,2 = -0.45

W2,1 = -6.2

W2,2 =  2.1

V1,1 =  0.15

V2,1 = -0.97

 

Use the sigmodial function 1/(1+e-x) to calculate the output value O (check Neural Network lecture for the formula)

 

O = ?

 

The Seq1 has been submitted to the NetSurfP program and output is shown below.

What is the most likely class that this protein belongs to: all-a, all-b, a+b, a/b or ‘small’

 

Explanation of classes:

  1. All-a: Mostly all residues are alpha-helical and coil
  2. All-b: Mostly all residues are beta-strands and coil
  3. a+b: Mixed regions with a-helices and b-strands
  4. a/b: Alternating a-helices and b-strands
  5. small: Mostly all secondary structure elements belong to the Coil category.

 

 

 

 

 

# Column 1: Class assignment - B for buried or E for Exposed - Threshold: 25% exposure, but not based on RSA

# Column 2: Amino acid

# Column 3: Sequence name

# Column 4: Amino acid number

# Column 5: Relative Surface Accessibility - RSA

# Column 6: Absolute Surface Accessibility

# Column 7: Z-fit score

# Column 8: Probability for Alpha-Helix

# Column 9: Probability for Beta-strand

# Column 10: Probability for Coil

E M  Seq1                   1    0.569 113.797  -1.139   0.109   0.005   0.886

E K  Seq1                   2    0.335  68.848   0.249   0.660   0.049   0.291

B T  Seq1                   3    0.214  29.723  -1.327   0.779   0.100   0.120

B A  Seq1                   4    0.198  21.776  -0.742   0.751   0.050   0.199

B A  Seq1                   5    0.162  17.819  -0.799   0.751   0.050   0.199

B L  Seq1                   6    0.159  29.131   0.323   0.717   0.014   0.269

B A  Seq1                   7    0.158  17.423   0.209   0.717   0.014   0.269

B P  Seq1                   8    0.149  21.129  -0.271   0.858   0.002   0.139

B L  Seq1                   9    0.110  20.196   0.154   0.802   0.014   0.185

B F  Seq1                  10    0.164  33.015  -1.128   0.782   0.003   0.216

B F  Seq1                  11    0.175  35.102  -0.660   0.782   0.003   0.216

B L  Seq1                  12    0.178  32.647   0.039   0.502   0.002   0.495

E P  Seq1                  13    0.373  52.886  -0.205   0.321   0.003   0.675

E S  Seq1                  14    0.584  68.421  -0.402   0.109   0.005   0.886

E A  Seq1                  15    0.484  53.326   0.311   0.053   0.005   0.942

E L  Seq1                  16    0.682 124.801   0.559   0.018   0.019   0.964

E A  Seq1                  17    0.463  51.078   0.532   0.005   0.015   0.979

B T  Seq1                  18    0.256  35.535   0.782   0.005   0.045   0.951

B T  Seq1                  19    0.152  21.055   1.956   0.002   0.816   0.182

B V  Seq1                  20    0.019   2.982   1.434   0.001   0.959   0.040

B Y  Seq1                  21    0.022   4.787   1.592   0.000   0.983   0.017

B L  Seq1                  22    0.013   2.380   1.711   0.000   0.983   0.017

B A  Seq1                  23    0.017   1.851   1.517   0.001   0.959   0.040

B G  Seq1                  24    0.024   1.920  -0.074   0.004   0.616   0.381

B D  Seq1                  25    0.050   7.234  -0.524   0.018   0.088   0.893

B S  Seq1                  26    0.031   3.633  -0.497   0.118   0.150   0.732

B T  Seq1                  27    0.042   5.825   0.604   0.125   0.227   0.648

B M  Seq1                  28    0.039   7.804  -0.374   0.199   0.152   0.649

B A  Seq1                  29    0.221  24.310  -0.172   0.113   0.043   0.844

E K  Seq1                  30    0.342  70.308  -0.758   0.053   0.043   0.903

E N  Seq1                  31    0.363  53.114  -0.714   0.018   0.047   0.935

E G  Seq1                  32    0.608  47.857  -2.471   0.018   0.019   0.964

E G  Seq1                  33    0.499  39.263  -2.306   0.018   0.019   0.964

E G  Seq1                  34    0.507  39.869  -1.803   0.018   0.019   0.964

E S  Seq1                  35    0.376  44.020  -0.832   0.058   0.017   0.925

E G  Seq1                  36    0.307  24.185  -1.598   0.115   0.016   0.868

E T  Seq1                  37    0.389  53.954  -1.736   0.113   0.043   0.844

E N  Seq1                  38    0.322  47.112  -1.299   0.113   0.043   0.844

B G  Seq1                  39    0.128  10.105  -2.730   0.181   0.016   0.803

B W  Seq1                  40    0.064  15.344   0.161   0.717   0.014   0.269

B G  Seq1                  41    0.127   9.956  -0.908   0.879   0.010   0.111

E E  Seq1                  42    0.531  92.748   0.292   0.858   0.002   0.139

B Y  Seq1                  43    0.166  35.453  -0.069   0.858   0.002   0.139

B L  Seq1                  44    0.043   7.947   0.368   0.858   0.002   0.139

E A  Seq1                  45    0.439  48.378   0.828   0.782   0.003   0.216

E S  Seq1                  46    0.733  85.908   0.635   0.694   0.003   0.303

E Y  Seq1                  47    0.280  59.772  -0.044   0.502   0.002   0.495

B L  Seq1                  48    0.172  31.493   0.383   0.181   0.016   0.803

E S  Seq1                  49    0.778  91.158   1.273   0.005   0.015   0.979

B A  Seq1                  50    0.141  15.538   0.368   0.004   0.138   0.858

E T  Seq1                  51    0.496  68.851   1.306   0.003   0.718   0.279

B V  Seq1                  52    0.041   6.332   0.030   0.001   0.959   0.040

B V  Seq1                  53    0.196  30.171   0.765   0.001   0.959   0.040

B N  Seq1                  54    0.072  10.526  -2.948   0.001   0.900   0.099

B D  Seq1                  55    0.223  32.105   0.273   0.004   0.514   0.481

B A  Seq1                  56    0.078   8.585  -3.514   0.004   0.420   0.576

B V  Seq1                  57    0.239  36.765   0.258   0.005   0.336   0.660

E A  Seq1                  58    0.293  32.256  -1.072   0.018   0.088   0.893

B G  Seq1                  59    0.216  17.039  -2.423   0.018   0.019   0.964

E R  Seq1                  60    0.323  73.944  -1.114   0.115   0.016   0.868

B S  Seq1                  61    0.166  19.467  -0.668   0.257   0.016   0.727

B A  Seq1                  62    0.062   6.854  -0.876   0.522   0.016   0.462

E R  Seq1                  63    0.409  93.615  -0.108   0.522   0.016   0.462

E S  Seq1                  64    0.373  43.680  -0.043   0.430   0.016   0.555

B Y  Seq1                  65    0.144  30.666  -0.717   0.430   0.016   0.555

E T  Seq1                  66    0.280  38.864   0.080   0.522   0.016   0.462

E R  Seq1                  67    0.518 118.599  -1.196   0.522   0.016   0.462

E E  Seq1                  68    0.438  76.484  -0.842   0.522   0.016   0.462

E G  Seq1                  69    0.367  28.859  -0.393   0.430   0.016   0.555

B R  Seq1                  70    0.194  44.540   0.592   0.522   0.016   0.462

B F  Seq1                  71    0.061  12.323   1.044   0.858   0.002   0.139

E E  Seq1                  72    0.459  80.187   1.279   0.923   0.002   0.076

E N  Seq1                  73    0.478  69.935   1.551   0.923   0.002   0.076

B I  Seq1                  74    0.051   9.342   0.632   0.923   0.002   0.076

B A  Seq1                  75    0.063   6.899   0.610   0.923   0.002   0.076

E D  Seq1                  76    0.600  86.532   1.247   0.858   0.002   0.139

E V  Seq1                  77    0.493  75.820   1.005   0.694   0.003   0.303

B V  Seq1                  78    0.122  18.705  -0.341   0.502   0.002   0.495

E T  Seq1                  79    0.504  69.974   0.626   0.109   0.005   0.886

E A  Seq1                  80    0.563  62.010   0.581   0.016   0.005   0.979

B G  Seq1                  81    0.178  14.009   0.072   0.005   0.015   0.979

E D  Seq1                  82    0.248  35.737   0.291   0.005   0.045   0.951

B Y  Seq1                  83    0.043   9.210   0.904   0.002   0.816   0.182

B V  Seq1                  84    0.015   2.336   1.753   0.001   0.959   0.040

B I  Seq1                  85    0.018   3.330   1.752   0.000   0.983   0.017

B V  Seq1                  86    0.016   2.413   1.456   0.000   0.983   0.017

B E  Seq1                  87    0.024   4.123   0.750   0.001   0.900   0.099

B F  Seq1                  88    0.023   4.556   0.972   0.004   0.514   0.481

B G  Seq1                  89    0.022   1.708   0.110   0.021   0.279   0.699

B H  Seq1                  90    0.049   8.877  -0.579   0.020   0.205   0.775

B N  Seq1                  91    0.030   4.465  -0.676   0.053   0.043   0.903

B D  Seq1                  92    0.039   5.605  -1.391   0.115   0.016   0.868

B G  Seq1                  93    0.169  13.308  -1.849   0.181   0.016   0.803

E G  Seq1                  94    0.300  23.634  -0.446   0.109   0.005   0.886

E S  Seq1                  95    0.332  38.934  -0.467   0.053   0.005   0.942

E L  Seq1                  96    0.596 109.183  -1.570   0.058   0.017   0.925

E S  Seq1                  97    0.481  56.397  -1.006   0.058   0.017   0.925

E T  Seq1                  98    0.393  54.440  -1.525   0.115   0.016   0.868

E D  Seq1                  99    0.584  84.097  -2.015   0.181   0.016   0.803

E N  Seq1                 100    0.495  72.483  -0.895   0.257   0.016   0.727

E G  Seq1                 101    0.310  24.428  -1.751   0.257   0.016   0.727

E R  Seq1                 102    0.350  80.104  -1.196   0.339   0.016   0.645

E T  Seq1                 103    0.392  54.343  -1.357   0.354   0.048   0.598

E D  Seq1                 104    0.375  54.052  -1.262   0.354   0.048   0.598

B C  Seq1                 105    0.265  37.220  -0.908   0.268   0.043   0.689

E S  Seq1                 106    0.419  49.119  -0.867   0.268   0.043   0.689

E G  Seq1                 107    0.435  34.219  -1.628   0.268   0.043   0.689

E T  Seq1                 108    0.386  53.566  -1.369   0.354   0.048   0.598

E G  Seq1                 109    0.433  34.046  -1.298   0.268   0.043   0.689

E A  Seq1                 110    0.468  51.596  -1.416   0.354   0.048   0.598

E E  Seq1                 111    0.444  77.584  -0.835   0.278   0.093   0.628

B V  Seq1                 112    0.257  39.578  -0.959   0.307   0.165   0.527

E C  Seq1                 113    0.292  40.983  -0.449   0.307   0.165   0.527

E Y  Seq1                 114    0.453  96.806  -0.832   0.307   0.165   0.527

E S  Seq1                 115    0.334  39.157  -1.278   0.307   0.165   0.527

E V  Seq1                 116    0.318  48.877  -1.400   0.278   0.093   0.628

E Y  Seq1                 117    0.445  95.011  -1.242   0.268   0.043   0.689

E D  Seq1                 118    0.543  78.232  -1.506   0.268   0.043   0.689

E G  Seq1                 119    0.426  33.495  -1.102   0.191   0.086   0.723

E V  Seq1                 120    0.462  71.025  -1.037   0.118   0.150   0.732

E N  Seq1                 121    0.535  78.383  -0.362   0.056   0.142   0.802

B E  Seq1                 122    0.260  45.405   0.200   0.018   0.088   0.893

E T  Seq1                 123    0.256  35.549   0.541   0.052   0.084   0.864

B I  Seq1                 124    0.153  28.342   0.137   0.802   0.014   0.185

E L  Seq1                 125    0.583 106.692   0.788   0.879   0.010   0.111

E T  Seq1                 126    0.352  48.892   1.687   0.938   0.007   0.055

B F  Seq1                 127    0.032   6.382   0.458   0.970   0.001   0.030

E P  Seq1                 128    0.285  40.498   1.312   0.970   0.001   0.030

E A  Seq1                 129    0.529  58.318   1.557   0.970   0.001   0.030

B Y  Seq1                 130    0.129  27.546   0.960   0.970   0.001   0.030

B L  Seq1                 131    0.014   2.545   1.743   0.988   0.000   0.012

E E  Seq1                 132    0.354  61.809   2.002   0.988   0.000   0.012

E N  Seq1                 133    0.411  60.200   2.264   0.988   0.000   0.012

B A  Seq1                 134    0.032   3.482   1.047   0.970   0.001   0.030

B A  Seq1                 135    0.021   2.347   1.192   0.970   0.001   0.030

E K  Seq1                 136    0.529 108.795   1.939   0.988   0.000   0.012

E L  Seq1                 137    0.281  51.433   1.669   0.970   0.001   0.030

B F  Seq1                 138    0.021   4.275   0.859   0.970   0.001   0.030

E T  Seq1                 139    0.421  58.434   1.601   0.923   0.002   0.076

E A  Seq1                 140    0.791  87.124   0.899   0.782   0.003   0.216

E K  Seq1                 141    0.476  97.810   1.130   0.176   0.004   0.820

E G  Seq1                 142    0.669  52.666  -0.246   0.003   0.003   0.994

B A  Seq1                 143    0.074   8.210  -0.154   0.005   0.015   0.979

E K  Seq1                 144    0.351  72.242   1.450   0.004   0.514   0.481

B V  Seq1                 145    0.041   6.332   0.717   0.001   0.900   0.099

B I  Seq1                 146    0.018   3.349   1.395   0.000   0.983   0.017

B L  Seq1                 147    0.020   3.735   0.878   0.000   0.983   0.017

B S  Seq1                 148    0.020   2.391   0.667   0.001   0.900   0.099

B S  Seq1                 149    0.027   3.153  -0.004   0.004   0.420   0.576

B Q  Seq1                 150    0.049   8.734  -0.304   0.019   0.141   0.840

B T  Seq1                 151    0.107  14.896  -0.193   0.020   0.205   0.775

B P  Seq1                 152    0.179  25.457  -1.121   0.019   0.141   0.840

B N  Seq1                 153    0.235  34.419  -1.091   0.018   0.088   0.893

E N  Seq1                 154    0.328  48.078  -1.224   0.018   0.047   0.935

E P  Seq1                 155    0.483  68.524  -1.448   0.058   0.017   0.925

E W  Seq1                 156    0.258  62.073  -0.866   0.058   0.017   0.925

E E  Seq1                 157    0.679 118.709  -1.238   0.053   0.005   0.942

E T  Seq1                 158    0.733 101.625  -1.811   0.053   0.005   0.942

E G  Seq1                 159    0.433  34.085  -1.725   0.058   0.017   0.925

E T  Seq1                 160    0.519  71.944   0.082   0.053   0.043   0.903

B F  Seq1                 161    0.173  34.661  -0.078   0.113   0.043   0.844

E V  Seq1                 162    0.364  56.008  -0.398   0.113   0.043   0.844

E N  Seq1                 163    0.537  78.631  -1.278   0.181   0.016   0.803

E S  Seq1                 164    0.339  39.789   0.175   0.181   0.016   0.803

B P  Seq1                 165    0.101  14.289  -0.016   0.858   0.002   0.139

E T  Seq1                 166    0.515  71.486   1.041   0.923   0.002   0.076

E R  Seq1                 167    0.431  98.791   1.400   0.923   0.002   0.076

B F  Seq1                 168    0.031   6.242   0.701   0.970   0.001   0.030

B V  Seq1                 169    0.086  13.203   0.604   0.970   0.001   0.030

E E  Seq1                 170    0.537  93.744   1.844   0.988   0.000   0.012

B Y  Seq1                 171    0.063  13.378   1.299   0.970   0.001   0.030

B A  Seq1                 172    0.017   1.862   1.571   0.988   0.000   0.012

E E  Seq1                 173    0.307  53.598   1.955   0.988   0.000   0.012

E L  Seq1                 174    0.464  84.995   2.011   0.988   0.000   0.012

B A  Seq1                 175    0.032   3.559   0.717   0.970   0.001   0.030

B A  Seq1                 176    0.019   2.127   0.286   0.970   0.001   0.030

E E  Seq1                 177    0.639 111.546   1.584   0.923   0.002   0.076

E V  Seq1                 178    0.611  93.880   1.004   0.858   0.002   0.139

E A  Seq1                 179    0.281  30.955   1.465   0.321   0.003   0.675

E G  Seq1                 180    0.778  61.236   1.058   0.003   0.003   0.994

B V  Seq1                 181    0.050   7.700   0.990   0.005   0.045   0.951

B E  Seq1                 182    0.278  48.602   0.656   0.004   0.420   0.576

B Y  Seq1                 183    0.065  13.869   0.634   0.001   0.900   0.099

B V  Seq1                 184    0.056   8.638   1.478   0.001   0.900   0.099

B D  Seq1                 185    0.154  22.177  -0.223   0.004   0.616   0.381

B H  Seq1                 186    0.082  14.861  -0.307   0.056   0.142   0.802

B W  Seq1                 187    0.203  48.846   0.383   0.257   0.016   0.727

E S  Seq1                 188    0.426  49.904   0.569   0.782   0.003   0.216

E Y  Seq1                 189    0.280  59.772   0.156   0.858   0.002   0.139

B V  Seq1                 190    0.037   5.625  -0.555   0.858   0.002   0.139

B D  Seq1                 191    0.213  30.693   0.858   0.970   0.001   0.030

E S  Seq1                 192    0.537  62.983   1.061   0.970   0.001   0.030

B I  Seq1                 193    0.110  20.387   0.727   0.970   0.001   0.030

B Y  Seq1                 194    0.053  11.283  -0.183   0.923   0.002   0.076

E E  Seq1                 195    0.586 102.339   0.962   0.923   0.002   0.076

E T  Seq1                 196    0.626  86.882   0.460   0.782   0.003   0.216

B L  Seq1                 197    0.187  34.185  -0.507   0.502   0.002   0.495

E G  Seq1                 198    0.322  25.310  -0.671   0.176   0.004   0.820

E N  Seq1                 199    0.516  75.498   0.013   0.321   0.003   0.675

E A  Seq1                 200    0.652  71.839  -0.242   0.430   0.016   0.555

E T  Seq1                 201    0.481  66.673  -0.431   0.339   0.016   0.645

B V  Seq1                 202    0.229  35.182  -0.284   0.339   0.016   0.645

E N  Seq1                 203    0.428  62.659   0.159   0.184   0.043   0.773

E S  Seq1                 204    0.604  70.754   0.632   0.113   0.043   0.844

B Y  Seq1                 205    0.145  31.072  -0.093   0.184   0.043   0.773

B F  Seq1                 206    0.111  22.258   0.091   0.052   0.084   0.864

E P  Seq1                 207    0.342  48.572  -0.417   0.053   0.043   0.903

E I  Seq1                 208    0.514  94.998  -0.666   0.018   0.019   0.964

B D  Seq1                 209    0.113  16.312  -2.243   0.018   0.019   0.964

B H  Seq1                 210    0.211  38.326  -0.787   0.018   0.047   0.935

B T  Seq1                 211    0.069   9.515  -1.066   0.004   0.085   0.910

B H  Seq1                 212    0.070  12.788   0.761   0.004   0.085   0.910

B T  Seq1                 213    0.124  17.240  -0.010   0.005   0.045   0.951

E S  Seq1                 214    0.237  27.730   1.227   0.016   0.005   0.979

E P  Seq1                 215    0.549  77.917  -0.046   0.858   0.002   0.139

E A  Seq1                 216    0.444  48.940   1.503   0.923   0.002   0.076

B G  Seq1                 217    0.025   1.952  -0.409   0.970   0.001   0.030

B A  Seq1                 218    0.054   5.929   0.351   0.970   0.001   0.030

E E  Seq1                 219    0.367  64.167   1.549   0.970   0.001   0.030

B V  Seq1                 220    0.104  15.923   1.395   0.970   0.001   0.030

B V  Seq1                 221    0.026   4.012   1.060   0.970   0.001   0.030

B A  Seq1                 222    0.024   2.623   0.947   0.970   0.001   0.030

E E  Seq1                 223    0.322  56.271   1.603   0.970   0.001   0.030

B A  Seq1                 224    0.097  10.689   1.215   0.988   0.000   0.012

B F  Seq1                 225    0.028   5.559   0.845   0.988   0.000   0.012

B L  Seq1                 226    0.057  10.363   1.158   0.988   0.000   0.012

E K  Seq1                 227    0.473  97.399   2.155   0.988   0.000   0.012

B A  Seq1                 228    0.118  12.982   0.627   0.970   0.001   0.030

B V  Seq1                 229    0.039   5.994  -0.263   0.970   0.001   0.030

E V  Seq1                 230    0.422  64.861   1.407   0.923   0.002   0.076

E C  Seq1                 231    0.763 107.139   0.865   0.694   0.003   0.303

E T  Seq1                 232    0.329  45.618   0.100   0.406   0.004   0.590

E G  Seq1                 233    0.380  29.898   0.226   0.176   0.004   0.820

E T  Seq1                 234    0.385  53.427  -0.183   0.321   0.003   0.675

E S  Seq1                 235    0.494  57.897   0.535   0.522   0.016   0.462

B L  Seq1                 236    0.042   7.709  -0.400   0.717   0.014   0.269

E K  Seq1                 237    0.287  59.056   1.487   0.717   0.014   0.269

E S  Seq1                 238    0.695  81.407   1.201   0.717   0.014   0.269

B V  Seq1                 239    0.262  40.331   0.740   0.622   0.015   0.363

B L  Seq1                 240    0.066  12.085  -0.334   0.430   0.016   0.555

E T  Seq1                 241    0.510  70.709   0.725   0.181   0.016   0.803

E T  Seq1                 242    0.538  74.593   1.148   0.113   0.043   0.844

E T  Seq1                 243    0.563  78.088  -0.656   0.115   0.016   0.868

E S  Seq1                 244    0.559  65.527  -0.382   0.058   0.017   0.925

B F  Seq1                 245    0.171  34.340  -0.222   0.053   0.005   0.942

E E  Seq1                 246    0.469  81.899  -0.251   0.053   0.005   0.942

E G  Seq1                 247    0.605  47.629  -1.763   0.018   0.019   0.964

E T  Seq1                 248    0.498  69.142   0.615   0.053   0.043   0.903

E C  Seq1                 249    0.396  55.641  -1.112   0.053   0.043   0.903

E L  Seq1                 250    0.569 104.239  -0.833   0.003   0.003   0.994