Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other

Introduktion til Bioinformatik - Sommereksamen 2009

Online materiale

Opgavetekst

Opgaveteksten i PDF format: SommerEksamen2009.pdf

Links og sekvenser:

Opgave 1:

LOCUS       KLON18.DNA    519 BP DS-DNA             UPDATED   06/14/98
DEFINITION  UWGCG file capture
ACCESSION   -
KEYWORDS    -
SOURCE      -
COMMENT     Non-sequence data from original file:
BASE COUNT      105 A    135 C    177 G    102 T      0 OTHER
ORIGIN      ?
    klon18.dna Length: 519   Jun 13, 1998 - 12:56 PM   Check: 7285 ..
        1 AATGGGCACG GGACGCATGT TGCCGGAACG ATTGTTGCGA TGCGCAATGA TGTGGGTGCG
       61 ACTGGAGTCG CCTATCGAGC CGATGTGATG CCCGTGCGCG TGTTGGATGC GGATGGCGCT
      121 GGCACCGATT ACGCGGTGGC GCAAGGGATC CGCTATGCGG TGGACAATGG TGCCGATATC
      181 GTCAACTTGA GCCTTGGTAG TTCGGGCTAT AGCACGTCGT TATCTTCGGC ACTGGACTAT
      241 GCCGCCAAGC ACAATGTGTT GATCGTATCG GCGGCCGGCA ACGAGGGCGC GAGCACGCCG
      301 GCCTATCCGG CGCGGCTCAG TAGTCGCTGG GAAAACGTGA TTTCGGTGGG AGCCCACGAT
      361 CGAGCGAACA AGACACCCAG TTTCAGTAAC GATGTAGGAA ACGTCGGCGC GGTGCAAGTT
      421 TCCGCGCCGG GTGTGGACGT CTATAGTACG CTGCCGAACG ATCGTTACGG GAAATTGAGT
      481 GGAACAAGCA TGGCAACCCC ACACGTCGCC GGCGCCGCC
//

Opgave  2:

>QUERY
HYEKRSFNIVHCNTDLTDSELEIVVVRGISYNVANPKDVDTYVRVEFPLLNDESFKTKTN
VIRDTSSPDYDERFKVDIQRTNRQFQRIFKRHGVKFEIYSRGGFLRSDTLIGTVNVKLQP
LETKCEIHDTYDLMDGRKQVGGKLEVKIRVRNPILTKQMEHITEKWLVLDA

BLAST LOGO:
http://www.cbs.dtu.dk/biotools/Blast2logo/teaching/45522804/blast2logo,4A13DA9B02B78A34.job.html