Events News Research CBS CBS Publications Bioinformatics
Staff Contact About Internal CBS CBS Other



Example of a sequence in FASTA format


>seq2 optional comment
ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPK
NMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGR
KSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARRELVISLIVES


Detailed description of the FASTA format is available at NCBI.


CORRESPONDENCE

Contact,