Services are gradually being migrated to https://services.healthtech.dtu.dk/.
Please try out the new site.



Example of a sequence in FASTA format


>seq2 optional comment
ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPK
NMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGR
KSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARRELVISLIVES


Detailed description of the FASTA format is available at NCBI.


CORRESPONDENCE

Contact,