Crenarchaeota Euryarchaeota Nanoarchaeota
Other Archaea
Classification of phyla is from NCBI page
Search:
54 projects found  

1 accessions found for Methanothermobacter thermautotrophicus str. Delta H  

Data for AE000666  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AE000666.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE000666_0357 CDS_307361-305259 168.3 4.1e-48 1
AE000666_0972 CDS_897936-899033 160.0 1.1e-45 1
AE000666_0814 CDS_749195-747162 158.8 2.6e-45 1
AE000666_0891 CDS_820089-818701 153.5 8.3e-44 1
AE000666_0443 CDS_383563-385314 153.4 8.8e-44 1
AE000666_0465 CDS_409809-408145 145.6 1.5e-41 1
AE000666_0353 CDS_297291-298994 144.3 3.3e-41 1
AE000666_0120 CDS_79510-78440 140.5 4.1e-40 1
AE000666_0456 CDS_399277-400764 137.6 2.8e-39 1
AE000666_0616 CDS_552991-555240 129.8 4.4e-37 1
AE000666_0890 CDS_818704-817646 124.3 1.6e-35 1
AE000666_0171 CDS_118633-120990 122.1 7.1e-35 1
AE000666_1104 CDS_1036400-1035354 108.6 4.9e-31 1
AE000666_0289 CDS_227212-228906 103.0 1.9e-29 1
AE000666_1240 CDS_1153404-1152340 65.6 8.3e-19 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE000666_0357 1/1 503 591 .. 1 94 [] 168.3 4.1e-48
AE000666_0972 1/1 167 254 .. 1 94 [] 160.0 1.1e-45
AE000666_0814 1/1 511 598 .. 1 94 [] 158.8 2.6e-45
AE000666_0891 1/1 272 358 .. 1 94 [] 153.5 8.3e-44
AE000666_0443 1/1 388 474 .. 1 94 [] 153.4 8.8e-44
AE000666_0465 1/1 367 454 .. 1 94 [] 145.6 1.5e-41
AE000666_0353 1/1 379 466 .. 1 94 [] 144.3 3.3e-41
AE000666_0120 1/1 162 250 .. 1 94 [] 140.5 4.1e-40
AE000666_0456 1/1 304 390 .. 1 94 [] 137.6 2.8e-39
AE000666_0616 1/1 556 639 .. 1 94 [] 129.8 4.4e-37
AE000666_0890 1/1 155 238 .. 1 94 [] 124.3 1.6e-35
AE000666_0171 1/1 594 675 .. 1 94 [] 122.1 7.1e-35
AE000666_1104 1/1 187 271 .. 1 94 [] 108.6 4.9e-31
AE000666_0289 1/1 373 460 .. 1 94 [] 103.0 1.9e-29
AE000666_1240 1/1 170 248 .. 9 94 .] 65.6 8.3e-19

Alignments of top-scoring domains:
AE000666_0357: domain 1 of 1, from 503 to 591: score 168.3, E = 4.1e-48
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISSLL+LQ+ +++d+ + +Lr+sq+R++S
AE000666_0 503 EIHHRVKNNLQVISSLLNLQSSYIDDPGI-----TGVLRDSQGRIMS 544

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m++iHE+LY+s++l +vd++ Y+e L+++++ sy++ +++++L++++
AE000666_0 545 MSMIHEKLYRSGNLADVDVRGYIEGLARSIMFSYMRPDQRVDLRFEI 591

AE000666_0972: domain 1 of 1, from 167 to 254: score 160.0, E = 1.1e-45
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLL+LQ++ ++d+ + + +L Esq+R++S
AE000666_0 167 EIHHRVKNNLQIISSLLSLQSHGIDDPSC-----RSLLSESQDRIRS 208

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s+d+++++fs+Y ++L++nL++sy+ g++ i+L+lD+
AE000666_0 209 MALIHEQLYRSGDFSSIEFSSYASRLLKNLKRSYAPGKN-IELSLDT 254

AE000666_0814: domain 1 of 1, from 511 to 598: score 158.8, E = 2.6e-45
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNL++ISSLL+LQ+r++kd+e+ +++rEs+nR +S
AE000666_0 511 EIHHRVKNNLMIISSLLSLQSRQAKDRET-----MDLFRESENRTRS 552

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m liHE+LY+sedl+++d++eYl +L++++f+sy+ +s i+Lkl++
AE000666_0 553 MVLIHERLYRSEDLKNIDLAEYLGRLASEIFRSYSADSR-IRLKLEI 598

AE000666_0891: domain 1 of 1, from 272 to 358: score 153.5, E = 8.3e-44
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLLrLQ+r+++de le+++E+qnRV+S
AE000666_0 272 EIHHRVKNNLQLISSLLRLQSRYIEDERS-----LEIFMECQNRVKS 313

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE+LY s+d+ v+++eY+e+L+++L++ ++++ + + l
AE000666_0 314 IALVHEKLYGSGDMMVVNLAEYIEELLSELRNMCRGRDTVFRTE--L 358

AE000666_0443: domain 1 of 1, from 388 to 474: score 153.4, E = 8.8e-44
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+IS LL+LQa + d+ +++ r+sq+R+ +
AE000666_0 388 EVHHRVKNNLQIISTLLMLQASTTGDKRL-----RDLYRDSQHRIDA 429

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++liHE+LY+s+dl++v++++Y++ L+++L++syg +s+gi+++ +
AE000666_0 430 ISLIHEKLYESRDLSRVNLRDYIKTLLSDLLDSYGADSNGIDVR--V 474

AE000666_0465: domain 1 of 1, from 367 to 454: score 145.6, E = 1.5e-41
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+ISSLL+LQ+ ++++ev +++L+Esq+R++
AE000666_0 367 EVHHRVKNNLQIISSLLNLQSLGTEGKEV-----RDVLMESQGRIKV 408

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA+iHE+LY+se+l +++f++Y+e+L+e+++ s+g + ++ +++D
AE000666_0 409 MAMIHEHLYRSESLASINFRDYVERLVEDIIISHGSSIRKV-IEVDD 454

AE000666_0353: domain 1 of 1, from 379 to 466: score 144.3, E = 3.3e-41
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+I SLL++Qa ++ +ee+ +e+Lr++q+RV++
AE000666_0 379 EVHHRVKNNLQIIMSLLNIQAMNA-SEEA-----REVLRDAQSRVRA 419

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA++HE Y s+++ vd+++++++L+e L ++ygv +++ ++++D+
AE000666_0 420 MAILHETIYDSGNFTGVDMGSFITRLIERLVSAYGVYGIHFRVDADV 466

AE000666_0120: domain 1 of 1, from 162 to 250: score 140.5, E = 4.1e-40
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI+HRVKNNL++ISS+L++Q+r++kd++ l ++rE+q+ ++
AE000666_0 162 EINHRVKNNLMIISSILNIQSRYVKDRDD-----LMLFREAQSKARA 203

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA++HE+LY+s+ +vdf+eYl+ L+++L +s+ +s++i L+ D+
AE000666_0 204 MAMLHERLYTSGKERRVDFGEYLRGLVRDLYHSFIQDSGRIGLETDI 250

AE000666_0456: domain 1 of 1, from 304 to 390: score 137.6, E = 2.8e-39
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+++SLL+LQ+ +++++e+ l++Lr+sq RV++
AE000666_0 304 EIHHRVKNNLQIVASLLSLQTAYTDNQET-----LNVLRDSQMRVRA 345

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA HE+ Y+s +l+ +++++Yl+ ++e++ + + g+ ++L+ +
AE000666_0 346 MAVAHEKIYRSSSLSMINVGDYLRAIAEEMTTLQSTGGLLVDLD--V 390

AE000666_0616: domain 1 of 1, from 556 to 639: score 129.8, E = 4.4e-37
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLL++Q r+ ++ee ++LrEs+ R++S
AE000666_0 556 EIHHRVKNNLQIISSLLSIQERQLESEEL-----SDVLRESRERIRS 597

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE+LY+s +l t+ ++ Yl+++++ L q ++g+d ++ +
AE000666_0 598 IALVHEHLYRSTNLRTIRIRNYLNNILSKLSQGQTHGKD---VR--I 639

AE000666_0890: domain 1 of 1, from 155 to 238: score 124.3, E = 1.6e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHRVKNNLQ+I+SLL+LQ r+++d+ v e +r+ +n +S
AE000666_0 155 ELHHRVKNNLQLIISLLSLQIRYIEDPGV-----EEFFRDYVNQLRS 196

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A+iHE+ Y s ++ +df eY++ L ++L++++g+ sd ++ +
AE000666_0 197 IAMIHERAYPSSGTYIIDFQEYVRSLSSHLISAHGRASD---VR--V 238

AE000666_0171: domain 1 of 1, from 594 to 675: score 122.1, E = 7.1e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNN QvISSL++LQ + ++d++ Lr+ q+R++S
AE000666_0 594 EVHHRVKNNFQVISSLINLQLDDAEDPAP--------LRDLQSRIQS 632

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE LY+sedl ++d++ Y+e+Lt+++ +s+ ++ i+++ +
AE000666_0 633 MALVHELLYESEDLTSIDMGRYIERLTSSIVNSH--HNGEIEVE--V 675

AE000666_1104: domain 1 of 1, from 187 to 271: score 108.6, E = 4.9e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHRVKNNLQ+ISSL+++Q+ k e++ e++r q R++S
AE000666_1 187 ELHHRVKNNLQIISSLISIQSSKMPREHA------EIMRSLQLRIKS 227

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A iHE+L s + +++ f++Y++ Lt++L++ y+ ++ ++lD+
AE000666_1 228 IAVIHEMLLSSPESSSISFASYVSGLTGYLRDMYQSAAE---FELDV 271

AE000666_0289: domain 1 of 1, from 373 to 460: score 103.0, E = 1.9e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRV+NNLQ+I+SL+++Q + ++++ v +eaL +q RV++
AE000666_0 373 ELQHRVRNNLQIITSLINIQLQDADGP-V-----KEALLATQTRVRA 413

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m +i+E LY ++++++v + + ++++te+L+++ g + g ++++Dl
AE000666_0 414 MTIIQESLYSTDGYSSVHIESCISRMTEHLKSLLGAHGVGFNIRADL 460

AE000666_1240: domain 1 of 1, from 170 to 248: score 65.6, E = 8.3e-19
*->NLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlSmAliHEeL
NLQ+I+S+++LQ ++kd++ e+Lr++qnR +S+ +E+L
AE000666_1 170 NLQLITSIVNLQFPYIKDKDD-----YELLRDTQNRLKSIRKAYEKL 211

YksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++ dt++f++Y + +++ ++++y+ + ++++L+ +
AE000666_1 212 IYEGSSDTINFGAYARSIVSGILSTYSPEPGRVRLE--M 248


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-15 1 0|=
-14 3 0|=
-13 22 11|=*==
-12 87 122|============= *
-11 398 341|================================================*========
-10 365 442|===================================================== *
-9 367 373|=====================================================*
-8 255 250|===================================*=
-7 123 148|================== *
-6 129 82|===========*=======
-5 50 44|======*=
-4 26 23|===*
-3 10 12|=*
-2 7 6|*
-1 5 3|*
0 4 1|*
1 1 0|=
2 0 0|
> 3 16 -|===


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 73.9175
P(chi-square) = 2.185e-11

Total sequences searched: 1869

Whole sequence top hits:
tophits_s report:
Total hits: 15
Satisfying E cutoff: 15
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 15
Satisfying E cutoff: 15
Total memory: 27K


Acknowledgements:

This research is funded by:

Developed by: