Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Caulobacter crescentus CB15  

Data for AE005673  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AE005673.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE005673_0284 CDS_299561-298212 128.7 1.8e-36 1
AE005673_3448 CDS_3717905-3716262 124.3 3.3e-35 1
AE005673_3172 CDS_3453468-3452485 51.6 1.6e-14 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE005673_0284 1/1 258 346 .. 1 94 [] 128.7 1.8e-36
AE005673_3448 1/1 348 426 .. 1 84 [. 124.3 3.3e-35
AE005673_3172 1/1 136 186 .. 1 56 [. 51.6 1.6e-14

Alignments of top-scoring domains:
AE005673_0284: domain 1 of 1, from 258 to 346: score 128.7, E = 1.8e-36
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKNNLQ+ISSLL LQ r++ d++v ++ Lr +RV +
AE005673_0 258 EVDHRVKNNLQLISSLLLLQNRRVPDPAV-----KASLRGMLGRVNA 299

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++L +sed+++ d+s++++ ++++L+ s+++++++++L+l+
AE005673_0 300 IATVHRRLFQSEDVERFDVSAFIRDMVADLMGSAMRDDIRVELDLER 346

AE005673_3448: domain 1 of 1, from 348 to 426: score 124.3, E = 3.3e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+I+SLL++Q r +d+++ ++a++++++R+ +
AE005673_3 348 EIHHRVKNNLQIITSLLNMQQRALSDPAA-----KAAMNDTRQRITA 389

mAliHEeLYksedldtvdfseYlekLtenLfqsygvg<-*
A+i++ LY++ dl++vd++++le+Lt++L+ s ++g
AE005673_3 390 LAQIYRALYQGPDLKRVDLRPFLEELTAQLLASDMGG 426

AE005673_3172: domain 1 of 1, from 136 to 186: score 51.6, E = 1.6e-14
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHRV NNL v+ +LLrLQ ++de++ + aL E+ +R+
AE005673_3 136 ELHHRVSNNLHVVGALLRLQGAGVQDEDA-----RHALAEAGGRIEL 177

mAliHEeLY<-*
+A i++eL+
AE005673_3 178 IAKIQRELH 186


Histogram of all scores:
score obs exp (one = represents 19 sequences)
----- --- ---
-15 6 0|=
-14 26 0|==
-13 57 23|=*=
-12 245 245|============*
-11 1080 683|===================================*=====================
-10 856 884|==============================================*
-9 588 746|=============================== *
-8 381 501|===================== *
-7 194 297|=========== *
-6 167 165|========*
-5 41 89|=== *
-4 46 47|==*
-3 18 24|=*
-2 10 12|*
-1 7 6|*
0 2 3|*
1 0 1|*
> 2 13 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 406.7000
P(chi-square) = 0

Total sequences searched: 3737

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: