Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Caulobacter crescentus CB15  

Data for AE005673  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AE005673.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE005673_3144 CDS_3415225-3416646 162.4 3.4e-55 1
AE005673_3022 CDS_3270386-3268617 155.3 9e-53 1
AE005673_0833 CDS_930776-933040 142.3 2.4e-48 1
AE005673_3032 CDS_3283765-3285162 141.7 4e-48 1
AE005673_0626 CDS_695748-697064 139.9 1.6e-47 1
AE005673_2537 CDS_2762112-2763128 139.4 2.3e-47 1
AE005673_1673 CDS_1857476-1855809 133.6 2.2e-45 1
AE005673_2883 CDS_3130503-3132173 128.3 1.4e-43 1
AE005673_3534 CDS_3808314-3810152 127.5 2.7e-43 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE005673_3144 1/1 279 360 .. 1 85 [] 162.4 3.4e-55
AE005673_3022 1/1 388 471 .. 1 85 [] 155.3 9e-53
AE005673_0833 1/1 568 648 .. 1 85 [] 142.3 2.4e-48
AE005673_3032 1/1 145 225 .. 1 85 [] 141.7 4e-48
AE005673_0626 1/1 243 325 .. 1 85 [] 139.9 1.6e-47
AE005673_2537 1/1 143 224 .. 1 85 [] 139.4 2.3e-47
AE005673_1673 1/1 372 448 .. 1 85 [] 133.6 2.2e-45
AE005673_2883 1/1 368 444 .. 1 85 [] 128.3 1.4e-43
AE005673_3534 1/1 282 361 .. 1 85 [] 127.5 2.7e-43

Alignments of top-scoring domains:
AE005673_3144: domain 1 of 1, from 279 to 360: score 162.4, E = 3.4e-55
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQS+a+QTlRn++s++ + e+F++RL+ Ls++Hd+
AE005673_3 279 ELNHRVKNTLATVQSMAAQTLRNEPSPAVAFEKFEARLMGLSGVHDI 325

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W gA Lre++e++L+P+ +e+++Ri++ GP+
AE005673_3 326 --LTRESWHGAPLREVAERALRPF-DEGGTRIEIAGPP 360

AE005673_3022: domain 1 of 1, from 388 to 471: score 155.3, E = 9e-53
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA +QSiarQTlR + ++ ++++F++RL+A+s+aH++
AE005673_3 388 ELNHRVKNTLASIQSIARQTLRADEVSPRARDQFIDRLMAMSAAHNV 434

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
Lt ++W+gA + ++l+++L+P+++++d+eRit++GP+
AE005673_3 435 --LTNERWSGAVIDDILREALRPFCDDrDPERITITGPS 471

AE005673_0833: domain 1 of 1, from 568 to 648: score 142.3, E = 2.4e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA++Q+ia+Q++++ +++de++eaFs R++AL++aHdL
AE005673_0 568 ELNHRVKNSLATIQAIAAQSFNGQRDMDEAKEAFSNRIVALAEAHDL 614

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W+gA++++++++ a +gg + R++lsG +
AE005673_0 615 --LTRENWEGAEMHDVAARVAALHGG--DARFELSGVA 648

AE005673_3032: domain 1 of 1, from 145 to 225: score 141.7, E = 4e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR KN L+vVQS+a+ T + +s+d++v+a+sgR+ +L+raH+L
AE005673_3 145 EVDHRAKNVLTVVQSLAQLT--PFESKDQYVQALSGRIGSLARAHSL 189

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ ++W+g+dL++Lle eL+Pygge++e+i + GP+
AE005673_3 190 --LSTTRWSGVDLHDLLELELDPYGGEAGEQIAILGPP 225

AE005673_0626: domain 1 of 1, from 243 to 325: score 139.9, E = 1.6e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQSi rQTlR+++s+++f++ F+ R+ ALs+aH L
AE005673_0 243 ELDHRVKNTLAIVQSITRQTLRTTPSPEAFADVFESRILALSQAHEL 289

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr+ W+ L e+l+++La ++++ a+R++++GP+
AE005673_0 290 --LTRRAWGRPQLEEILQRTLATFADDVAGRFEVQGPA 325

AE005673_2537: domain 1 of 1, from 143 to 224: score 139.4, E = 2.3e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQSia+Q+lRna+ ++ ++a++gRL+A +++H++
AE005673_2 143 ELNHRVKNTLATVQSIANQSLRNAGVDASVRDALEGRLMAIAATHNV 189

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+ +W+ A+Lr+++ + Py+++ ++++t+sG+d
AE005673_2 190 --LTDQNWSAASLRQIVDGSVTPYRAN-PGQLTISGDD 224

AE005673_1673: domain 1 of 1, from 372 to 448: score 133.6, E = 2.2e-45
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtL vVQS+ar++l+ + + +++F RL AL++aHdL
AE005673_1 372 ELNHRVKNTLVVVQSLARHSLK--GGGELGLAQFNERLLALAGAHDL 416

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W+gAdL+eL++++L+Py a+++ ++GP+
AE005673_1 417 --LTRRSWEGADLGELVAEALQPY----ATQVSIEGPA 448

AE005673_2883: domain 1 of 1, from 368 to 444: score 128.3, E = 1.4e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQ++arQT +a + ++ F++RL ALs+aHdL
AE005673_2 368 ELNHRVKNTLATVQALARQT--FAKVDGAPLGVFTDRLIALSGAHDL 412

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr+ W+ Ad+++L+ea L+++ ++R+ +GP+
AE005673_2 413 --LTRTGWREADMAALIEASLGAH----GDRVDREGPT 444

AE005673_3534: domain 1 of 1, from 282 to 361: score 127.5, E = 2.7e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+LAvVQS+a+Q++R +asld f+ +F++RL ++s+aHdL
AE005673_3 282 ELDHRIKNLLAVVQSVAAQSARKSASLDVFLKTFAARLKSMSSAHDL 328

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ ++W+gA+L+ +++aeL+ + +++ +++GP+
AE005673_3 329 --LSAARWRGATLARIAAAELGGLA---PTQTRWDGPE 361


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-15 1 0|=
-14 14 0|==
-13 39 0|===
-12 239 0|===================
-11 307 30|==*=====================
-10 482 386|=============================*========
-9 690 956|====================================================== *
-8 750 992|==========================================================*
-7 469 667|===================================== *
-6 307 364|======================== *
-5 182 180|=============*
-4 93 85|======*=
-3 76 39|==*===
-2 39 18|=*=
-1 17 8|*=
0 7 3|*
1 10 1|*
2 1 0|=
3 1 0|=
> 4 13 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2794.0247
P(chi-square) = 0

Total sequences searched: 3737

Whole sequence top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: