Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Sinorhizobium meliloti 1021  

Data for AE006469  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AE006469.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE006469_0057 CDS_59703-62264 143.7 2.7e-49 1
AE006469_1127 CDS_1164048-1165091 126.1 2.7e-43 1
AE006469_0539 CDS_554230-555633 113.9 3.9e-39 1
AE006469_0931 CDS_955590-956786 109.9 8.9e-38 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE006469_0057 1/1 667 748 .. 1 85 [] 143.7 2.7e-49
AE006469_1127 1/1 153 235 .. 1 85 [] 126.1 2.7e-43
AE006469_0539 1/1 271 360 .. 1 85 [] 113.9 3.9e-39
AE006469_0931 1/1 203 292 .. 1 85 [] 109.9 8.9e-38

Alignments of top-scoring domains:
AE006469_0057: domain 1 of 1, from 667 to 748: score 143.7, E = 2.7e-49
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQS+a+QT+R+ + +++ ++F RL+AL+raHd+
AE006469_0 667 ELNHRVKNTLATVQSLAAQTFRGVNASED-FGRFQSRLVALARAHDV 712

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W+gAdL+e+l a++ P + e ++R++ sGP+
AE006469_0 713 --LTRESWQGADLGEVLHATINPICVEPQQRVQASGPP 748

AE006469_1127: domain 1 of 1, from 153 to 235: score 126.1, E = 2.7e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA ++Si+++T+R+a sldef+e+F+gRL+AL+++H+
AE006469_1 153 ELNHRVKNILASISSIFQMTRRRAVSLDEFAEDFAGRLAALANVHSA 199

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+++++++ ++++ ++e +++Py+ + +R++++GP+
AE006469_1 200 --VFQADGEAVEFSSVVELTFSPYRVRGTDRLVFTGPT 235

AE006469_0539: domain 1 of 1, from 271 to 360: score 113.9, E = 3.9e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HR KN++++ S++r ++R+++ +d++v+ +sgRL+AL++aH+L
AE006469_0 271 EMGHRLKNLFTILDSMVRISARSTDNKDDLVALLSGRLHALAAAHSL 317

V.p.LtrseWagAdLreLleaeLaPygged...aeRitlsGPd<-*
V+p++++ ++a +L+eLl++ L+P+++++ ++ +R+ l+GP+
AE006469_0 318 VkPsFSDVQGAASSLAELLSIVLEPHEQPAisgKRRLSLTGPT 360

AE006469_0931: domain 1 of 1, from 203 to 292: score 109.9, E = 8.9e-38
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR KN++++V +++r ++R+++ +d++v+ +sgRL+AL++aH+L
AE006469_0 203 EMSHRLKNLFTIVDGMIRISARSTDNKDDLVALLSGRLHALAAAHSL 249

V.p.LtrseWagAdLreLleaeLaPygged...aeRitlsGPd<-*
V+p++++ ++a L+eLl++ +P++++++++++R+ l GP+
AE006469_0 250 VrPsFSDVQGAASNLAELLSIVTEPHEPPAtggRRRLSLRGPS 292


Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-14 4 0|=
-13 14 0|====
-12 116 0|=============================
-11 129 10|==*==============================
-10 210 133|=================================*===================
-9 235 331|==========================================================*
-8 215 343|====================================================== *
-7 152 230|====================================== *
-6 83 126|===================== *
-5 64 62|===============*
-4 28 29|=======*
-3 17 13|===*=
-2 10 6|=*=
-1 3 2|*
0 6 1|*=
1 2 0|=
2 1 0|=
> 3 5 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 1490.5437
P(chi-square) = 0

Total sequences searched: 1294

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: