Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Agrobacterium tumefaciens str. C58  

Data for AE007869  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AE007869.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE007869_2085 CDS_2130595-2133147 113.8 8.6e-39 1
AE007869_1921 CDS_1953663-1952635 104.6 1.2e-35 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE007869_2085 1/1 520 600 .. 1 85 [] 113.8 8.6e-39
AE007869_1921 1/1 154 235 .. 1 85 [] 104.6 1.2e-35

Alignments of top-scoring domains:
AE007869_2085: domain 1 of 1, from 520 to 600: score 113.8, E = 8.6e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN LA++ S++ ++ +l+e+v+a+ gR+qALs aHd+
AE007869_2 520 ELNHRVKNVLAIIKSLVGNPSQEGKTLQEYVTALKGRIQALSFAHDQ 566

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+ r e +g+ Lr+LleaeL+P++++ ++ + l+GP+
AE007869_2 567 --IIRGE-GGGALRDLLEAELSPHRSP-ETTVKLEGPQ 600

AE007869_1921: domain 1 of 1, from 154 to 235: score 104.6, E = 1.2e-35
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNt+A+V Si+r T+++++s++++ e++ +R AL+++H L
AE007869_1 154 ELSHRVKNTMAMVVSIIRRTAKGSTSIKDYQERLVARVSALAESHAL 200

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++s+W+ Lr+++ ++++P+++ a R++l+GPd
AE007869_1 201 --LFQSNWGETNLRDVVKRAIEPHNT-FASRVELEGPD 235


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-16 1 0|=
-15 0 0|
-14 11 0|==
-13 46 0|======
-12 225 0|=========================
-11 303 22|==*===============================
-10 430 281|===============================*================
-9 481 696|====================================================== *
-8 485 723|====================================================== *
-7 289 485|================================= *
-6 175 265|==================== *
-5 129 131|==============*
-4 68 62|======*=
-3 31 28|===*
-2 23 13|=*=
-1 9 6|*
0 6 2|*
1 4 1|*
2 0 0|
> 3 6 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 3886.6946
P(chi-square) = 0

Total sequences searched: 2722

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: