hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AE007872.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE007872_0262 CDS_265349-266761 73.6 2.9e-22 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE007872_0262 1/1 255 322 .. 1 70 [] 73.6 2.9e-22
Alignments of top-scoring domains:
AE007872_0262: domain 1 of 1, from 255 to 322: score 73.6, E = 2.9e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+++Q+L +++ ++larr + + d+ a ea+
AE007872_0 255 ERLRIARELHDGISQNLVGVRFAIDLARRKV--TPDNVGAVEAIGKG 299
relarealaevRrllgdLRpaal<-*
+ ++ ea++evRr+ +dLRp +l
AE007872_0 300 ASALTEAIKEVRRISHDLRPRVL 322
Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-14 6 0|===
-13 11 0|======
-12 22 6|==*========
-11 33 50|================= *
-10 77 116|======================================= *
-9 93 132|=============================================== *
-8 77 101|======================================= *
-7 59 64|============================== *
-6 64 36|=================*==============
-5 56 19|=========*==================
-4 21 10|====*======
-3 14 5|==*====
-2 4 2|*=
-1 3 1|*=
0 0 0|
1 2 0|=
2 2 0|=
3 1 0|=
4 0 0|
5 0 0|
> 6 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 195.0325
P(chi-square) = 3.64e-37
Total sequences searched: 547
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K