Crenarchaeota Euryarchaeota Nanoarchaeota
Other Archaea
Classification of phyla is from NCBI page
Search:
82 projects found  

1 accessions found for Methanosarcina mazei Go1  

Data for AE008384  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AE008384.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE008384_1915 CDS_2274419-2276245 199.4 3.1e-57 1
AE008384_2748 CDS_3290910-3293798 198.5 6e-57 1
AE008384_0169 CDS_226247-223959 197.8 9.7e-57 1
AE008384_1777 CDS_2120683-2122620 192.6 3.5e-55 1
AE008384_2275 CDS_2707000-2703485 192.4 4.2e-55 1
AE008384_0889 CDS_1050470-1048887 191.3 8.8e-55 1
AE008384_1781 CDS_2126112-2128052 191.1 9.8e-55 1
AE008384_2646 CDS_3161120-3158469 187.9 9e-54 1
AE008384_2276 CDS_2710908-2707585 187.6 1.2e-53 1
AE008384_0168 CDS_223908-219154 187.3 1.4e-53 1
AE008384_2277 CDS_2715223-2711444 186.9 1.8e-53 1
AE008384_0518 CDS_646849-644144 186.6 2.3e-53 1
AE008384_1093 CDS_1285023-1287518 186.1 3.2e-53 1
AE008384_1671 CDS_2001789-2004335 184.1 1.3e-52 1
AE008384_2965 CDS_3577497-3580016 183.4 2.1e-52 1
AE008384_2886 CDS_3471083-3469077 180.8 1.2e-51 1
AE008384_2435 CDS_2906493-2909150 179.8 2.5e-51 1
AE008384_2515 CDS_2998422-3001574 179.2 4e-51 1
AE008384_3295 CDS_4013955-4011184 177.5 1.3e-50 1
AE008384_2955 CDS_3566295-3563665 172.9 2.9e-49 1
AE008384_2990 CDS_3615047-3613803 161.3 8.6e-46 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE008384_1915 1/1 400 492 .. 1 94 [] 199.4 3.1e-57
AE008384_2748 1/1 736 830 .. 1 94 [] 198.5 6e-57
AE008384_0169 1/1 547 635 .. 1 94 [] 197.8 9.7e-57
AE008384_1777 1/1 430 518 .. 1 94 [] 192.6 3.5e-55
AE008384_2275 1/1 954 1048 .. 1 94 [] 192.4 4.2e-55
AE008384_0889 1/1 319 411 .. 1 94 [] 191.3 8.8e-55
AE008384_1781 1/1 435 523 .. 1 94 [] 191.1 9.8e-55
AE008384_2646 1/1 642 736 .. 1 94 [] 187.9 9e-54
AE008384_2276 1/1 881 975 .. 1 94 [] 187.6 1.2e-53
AE008384_0168 1/1 1368 1456 .. 1 94 [] 187.3 1.4e-53
AE008384_2277 1/1 1040 1134 .. 1 94 [] 186.9 1.8e-53
AE008384_0518 1/1 683 775 .. 1 94 [] 186.6 2.3e-53
AE008384_1093 1/1 617 705 .. 1 94 [] 186.1 3.2e-53
AE008384_1671 1/1 639 727 .. 1 94 [] 184.1 1.3e-52
AE008384_2965 1/1 635 723 .. 1 94 [] 183.4 2.1e-52
AE008384_2886 1/1 450 541 .. 1 94 [] 180.8 1.2e-51
AE008384_2435 1/1 667 761 .. 1 94 [] 179.8 2.5e-51
AE008384_2515 1/1 820 908 .. 1 94 [] 179.2 4e-51
AE008384_3295 1/1 708 796 .. 1 94 [] 177.5 1.3e-50
AE008384_2955 1/1 636 724 .. 1 94 [] 172.9 2.9e-49
AE008384_2990 1/1 196 283 .. 1 94 [] 161.3 8.6e-46

Alignments of top-scoring domains:
AE008384_1915: domain 1 of 1, from 400 to 492: score 199.4, E = 3.1e-57
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf ++e ikd EVl a+rEsq+RV+
AE008384_1 400 EIHHRIKNNLQVISSLLDLQAEKFNNREDIKDlEVLSAFRESQDRVK 446

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeLY++++ldt++fs+Y+e+L+enLf++y++g+d+++L+ +
AE008384_1 447 SMALIHEELYRGGGLDTLNFSSYIEELVENLFRTYRLGNDNLRLN--V 492

*

AE008384_1 - -

AE008384_2748: domain 1 of 1, from 736 to 830: score 198.5, E = 6e-57
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa++fk++e ikd EVl a+rEsq+RV+
AE008384_2 736 EIHHRIKNNLQVISSLLDLQADQFKNREDIKDlEVLSAFRESQDRVI 782

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeLY++ +++t++fs+Y+++LtenLf++y++g+ +i L+ Dl
AE008384_2 783 SMALIHEELYRGSGFETLNFSPYIQELTENLFNTYSLGDTRITLSMDL 830

*

AE008384_2 - -

AE008384_0169: domain 1 of 1, from 547 to 635: score 197.8, E = 9.7e-57
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf+++ v +ea+rEsqnRV+S
AE008384_0 547 EIHHRIKNNLQVISSLLDLQADKFDNPTV-----IEAFRESQNRVIS 588

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLYk+e++dt++fs Y+++L+enLfq+y+++s++i+L+ Dl
AE008384_0 589 MALIHEELYKGENTDTLNFSTYIKELAENLFQTYSLSSKNIHLNMDL 635

AE008384_1777: domain 1 of 1, from 430 to 518: score 192.6, E = 3.5e-55
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+L+a+kf+d++ le +rEsqnRV+S
AE008384_1 430 EIHHRIKNNLQVISSLLSLEAEKFSDRKM-----LESFRESQNRVAS 471

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLYk+ d+dt+dfs+Yl+kLt++L+ sy+vg+d+i L+lDl
AE008384_1 472 MALIHEELYKGSDMDTLDFSAYLRKLTADLLASYRVGNDKITLRLDL 518

AE008384_2275: domain 1 of 1, from 954 to 1048: score 192.4, E = 4.2e-55
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf+d++ ++++EVl+a+rEsq+RV+
AE008384_2 954 EIHHRIKNNLQVISSLLDLQAEKFRDRKYVENsEVLNAFRESQDRVI 1000

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+AliHEeL+++++ dt++fs+Yl++L++nLf++y++g+ +isL+ Dl
AE008384_2 1001 SIALIHEELHEGRGKDTLNFSPYLQRLVKNLFHTYTLGNADISLNMDL 1048

*

AE008384_2 - -

AE008384_0889: domain 1 of 1, from 319 to 411: score 191.3, E = 8.8e-55
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+ f +e+++++E+lea+rEsqnRV+
AE008384_0 319 EIHHRIKNNLQVISSLLDLQAETFNHRETVTApEILEAFRESQNRVI 365

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
Sm+liHEeLY++e++dt++fs Yl+kL+e L+q+y++++++isL +
AE008384_0 366 SMSLIHEELYRGEGTDTLNFSVYLRKLAEKLLQTYSLSNKNISLF--M 411

*

AE008384_0 - -

AE008384_1781: domain 1 of 1, from 435 to 523: score 191.1, E = 9.8e-55
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHR+KNNLQvISSLL+LQa+kf+d+ev +ea+rEsqnRV+S
AE008384_1 435 EVHHRIKNNLQVISSLLSLQAEKFDDREV-----IEAFRESQNRVAS 476

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A+iHEeL+ +e+ d++df+ Yl+kLt++Lf+sy+vg+dgi+L l+l
AE008384_1 477 IAMIHEELHGGESPDSLDFAGYLQKLTSDLFNSYRVGKDGINLTLEL 523

AE008384_2646: domain 1 of 1, from 642 to 736: score 187.9, E = 9e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa++f+++ +ik+++Vl+a+rEsq+R++
AE008384_2 642 EIHHRIKNNLQVISSLLDLQAENFSSKTCIKNsDVLNAFRESQDRIM 688

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+AliHEeL+++++ + fs+YlekL+enLfq+y++g+ isL Dl
AE008384_2 689 SIALIHEELHEGGGNNALYFSPYLEKLVENLFQTYSLGNASISLYTDL 736

*

AE008384_2 - -

AE008384_2276: domain 1 of 1, from 881 to 975: score 187.6, E = 1.2e-53
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf+ +e kd EVl+a+rEsq+RV+
AE008384_2 881 EIHHRIKNNLQVISSLLDLQAEKFRAREHFKDlEVLNAFRESQDRVI 927

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+AliHEeL+++++ dt++fs+Yl +L+enLfq+y++g+ +isL+ Dl
AE008384_2 928 SIALIHEELHEGKGKDTLNFSPYLHRLVENLFQTYTLGNADISLNMDL 975

*

AE008384_2 - -

AE008384_0168: domain 1 of 1, from 1368 to 1456: score 187.3, E = 1.4e-53
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQ+ISSLL+LQa+kf+de+v +e +rE qnRV+S
AE008384_0 1368 EIHHRIKNNLQIISSLLDLQAEKFEDENV-----IESFREGQNRVIS 1409

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liHEeLYk+e++dt+dfs+Y++kL+enLf++y+++s++isL+ Dl
AE008384_0 1410 MSLIHEELYKGEGTDTLDFSAYFKKLAENLFKTYNLSSKNISLSMDL 1456

AE008384_2277: domain 1 of 1, from 1040 to 1134: score 186.9, E = 1.8e-53
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kfk+++ + d +Vl aL+Esq+RV+
AE008384_2 1040 EIHHRIKNNLQVISSLLDLQAEKFKNKKNTGDvDVLTALKESQDRVM 1086

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+AliHE+L++s+++d++dfs+Yl kL+e+Lfq+y++g++++sL+ Dl
AE008384_2 1087 SIALIHEKLHESKGTDKLDFSPYLMKLVESLFQTYNLGNKDLSLDMDL 1134

*

AE008384_2 - -

AE008384_0518: domain 1 of 1, from 683 to 775: score 186.6, E = 2.3e-53
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvI SLL+LQa+kf+++e +d+EVl+a+ EsqnRV+
AE008384_0 683 EIHHRIKNNLQVICSLLDLQAEKFRSRESAEDtEVLNAFIESQNRVM 729

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+AliHEeL++++++dt++fs+YlekL+enLfq+y +++ + sL+ +
AE008384_0 730 SIALIHEELHEGRGTDTLNFSPYLEKLVENLFQTYILENVNTSLD--I 775

*

AE008384_0 - -

AE008384_1093: domain 1 of 1, from 617 to 705: score 186.1, E = 3.2e-53
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvI SLL+L+a++f+de+ le L+EsqnRV+S
AE008384_1 617 EIHHRIKNNLQVICSLLSLEAERFSDEKM-----LETLKESQNRVAS 658

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLYk++ dt+df++Yl+kLt++Lf+sy++g+d+isLk Dl
AE008384_1 659 MALIHEELYKGDKNDTLDFAAYLRKLTADLFSSYNLGNDNISLKMDL 705

AE008384_1671: domain 1 of 1, from 639 to 727: score 184.1, E = 1.3e-52
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+L+++kf+d ++ le +rEsqnRV+S
AE008384_1 639 EIHHRIKNNLQVISSLLSLESEKFSDAKI-----LESFRESQNRVAS 680

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLYk+ +ldt+df++Y+++Lt++Lf++y+++++g+sLklDl
AE008384_1 681 MALIHEELYKGNELDTLDFADYIQNLTSDLFDLYSLRNSGVSLKLDL 727

AE008384_2965: domain 1 of 1, from 635 to 723: score 183.4, E = 2.1e-52
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvIS LL L++ +f+de+v +ea+rEsq+RV+S
AE008384_2 635 EIHHRIKNNLQVISTLLYLESGNFSDEKV-----IEAFRESQHRVKS 676

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LY+sed+ +vdfs+Y+++L+++Lf +y+vg+++isLklD+
AE008384_2 677 MALVHEKLYQSEDMISVDFSDYIQNLANYLFGAYSVGDKNISLKLDV 723

AE008384_2886: domain 1 of 1, from 450 to 541: score 180.8, E = 1.2e-51
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa++f+d++v +e +++sqnRV+S
AE008384_2 450 EIHHRIKNNLQVISSLLSLQAENFSDKKV-----KESFHDSQNRVIS 491

mAliHEeLYkse...dldtvdfseYlekLtenLfqsygvgsdgisLklDl
m+liHEeLY++++++d+++ df++Y++kL+++Lf+sy vg+++++LklD+
AE008384_2 492 MSLIHEELYRTGetgDVESFDFKAYIQKLANELFRSYVVGNKDLHLKLDM 541

<-*

AE008384_2 - -

AE008384_2435: domain 1 of 1, from 667 to 761: score 179.8, E = 2.5e-51
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+L a+kf++++ + EVlea+rEsqnRV+
AE008384_2 667 EIHHRIKNNLQVISSLLDLAAEKFRNKNHLDSyEVLEAFRESQNRVM 713

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+A iH+eL+++e+l++++fs YlekL+enLfq+y+vg +gisL+lDl
AE008384_2 714 SIAYIHKELHEGEGLEKLNFSLYLEKLAENLFQTYSVGHSGISLDLDL 761

*

AE008384_2 - -

AE008384_2515: domain 1 of 1, from 820 to 908: score 179.2, E = 4e-51
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL LQa+kfkd +v lea+rEsqnRV +
AE008384_2 820 EIHHRIKNNLQVISSLLELQAEKFKDINV-----LEAFRESQNRVST 861

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA+iHEeLY+s++ + +dfs+Yl+kLte+Lfq+y v++++++ lD+
AE008384_2 862 MAIIHEELYRSKNNEALDFSAYLQKLTEELFQTYVVRKGDVDMQLDI 908

AE008384_3295: domain 1 of 1, from 708 to 796: score 177.5, E = 1.3e-50
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQ++SSLL+LQa+kfkd++v +ea+rEs+nRV+S
AE008384_3 708 EIHHRIKNNLQIVSSLLSLQADKFKDRDV-----IEAFRESENRVAS 749

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m++iHEeL+ksed+ ++df++Yl+kLt++L+ sy+ g+++++L lD+
AE008384_3 750 MSIIHEELHKSEDTTSIDFAAYLRKLTSELLYSYRIGNEKVHLFLDV 796

AE008384_2955: domain 1 of 1, from 636 to 724: score 172.9, E = 2.9e-49
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvIS LL L++ +f+de+v +ea+ Esq+RV+S
AE008384_2 636 EIHHRIKNNLQVISTLLYLESGNFSDEKV-----IEAFIESQHRVKS 677

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LY+sed+ +vdf++Y++ L ++Lf+sy+vg++++sL+lD+
AE008384_2 678 MALVHEKLYQSEDMVSVDFADYIKDLSDYLFHSYSVGDGNVSLRLDI 724

AE008384_2990: domain 1 of 1, from 196 to 283: score 161.3, E = 8.6e-46
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HR+KNNLQvISSLL+L+a+k++d+e+ le++r sqnR+++
AE008384_2 196 EVNHRIKNNLQVISSLLSLEAEKSTDPEI-----LEVFRKSQNRIAT 237

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liH++L + ++ +dfs+Yl+kLte Lf sy+vg ++++L+l+l
AE008384_2 238 MSLIHQKLCIG-ETHIIDFSDYLRKLTEGLFGSYRVGTERVNLRLEL 283


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-15 4 0|=
-14 9 0|=
-13 28 21|=*
-12 159 221|============ *
-11 783 616|===========================================*============
-10 667 797|================================================ *
-9 634 673|============================================== *
-8 413 452|============================== *
-7 248 268|================== *
-6 227 149|==========*======
-5 74 80|=====*
-4 48 42|==*=
-3 29 22|=*=
-2 17 11|*=
-1 5 6|*
0 1 3|*
1 1 1|*
2 1 0|=
3 1 0|=
> 4 22 -|==


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 139.4392
P(chi-square) = 7.773e-24

Total sequences searched: 3371

Whole sequence top hits:
tophits_s report:
Total hits: 21
Satisfying E cutoff: 21
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 21
Satisfying E cutoff: 21
Total memory: 29K


Acknowledgements:

This research is funded by:

Developed by: