Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Zymomonas mobilis subsp. mobilis ZM4  

Data for AE008692  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AE008692.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE008692_1216 CDS_1240284-1241936 64.5 1.8e-18 1
AE008692_0548 CDS_543226-542213 62.5 6.6e-18 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE008692_1216 1/1 356 445 .. 1 94 [] 64.5 1.8e-18
AE008692_0548 1/1 145 232 .. 1 94 [] 62.5 6.6e-18

Alignments of top-scoring domains:
AE008692_1216: domain 1 of 1, from 356 to 445: score 64.5, E = 1.8e-18
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQv+SSLL++++r+++ + + a q+RV +
AE008692_1 356 EVHHRVKNNLQVVSSLLSIHSRRAETAKE-----KSAYATIQRRVNA 397

mAliHEeLYksedldt.vdfseYlekLtenLfqsygvgsdgisLklDl<-
A+++++ Y d ++++d+s +++L++ L s + ++ +++ ++
AE008692_1 398 LAIVQRQYYNELDKGQgLDLSLLIKELVNGLQTSLQTFEKNFQIETEI 445

*

AE008692_1 - -

AE008692_0548: domain 1 of 1, from 145 to 232: score 62.5, E = 6.6e-18
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HR+ NNLQvI+SLLr+Q+r+++de++ +ea s++R+
AE008692_0 145 ELQHRISNNLQVIASLLRMQSRSITDEKA-----KEAIDASVRRIHM 186

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+ +++ LY + ++ + l++L+++ + s ++ +++ +++++
AE008692_0 187 IGELQRALYIKNG-NQLGAKLILDRLIKEVIASSNLPNIRYKIEAED 232


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-15 12 0|==
-14 34 0|=====
-13 56 12|=*=====
-12 150 131|================*==
-11 456 365|=============================================*===========
-10 412 472|==================================================== *
-9 327 399|========================================= *
-8 212 267|=========================== *
-7 140 159|================== *
-6 103 88|==========*==
-5 44 47|=====*
-4 21 25|===*
-3 13 13|=*
-2 7 6|*
-1 5 3|*
0 1 1|*
1 1 0|=
> 2 4 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 214.6455
P(chi-square) = 1.274e-309

Total sequences searched: 1998

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: