hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AE008917.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE008917_1582 CDS_1632598-1631279 76.7 1.3e-22 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE008917_1582 1/1 234 301 .. 1 70 [] 76.7 1.3e-22
Alignments of top-scoring domains:
AE008917_1582: domain 1 of 1, from 234 to 301: score 76.7, E = 1.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD+++Q+L +++ ++la r++ ++ + a +a++ +
AE008917_1 234 ERARLARELHDGISQNLVGVRYAIDLASRQV--RTGSGGAPQAIEKA 278
relarealaevRrllgdLRpaal<-*
++++ a++evRrl +dLRp +l
AE008917_1 279 SDALNGAIKEVRRLSHDLRPRIL 301
Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 7 0|=
-13 30 0|=====
-12 74 22|===*=======
-11 108 188|================ *
-10 319 437|============================================== *
-9 391 497|======================================================== *
-8 303 383|============================================ *
-7 244 240|==================================*
-6 191 136|===================*========
-5 166 73|==========*=============
-4 77 38|=====*=====
-3 57 19|==*======
-2 33 10|=*===
-1 34 5|*====
0 8 2|*=
1 7 1|*
2 3 0|=
3 5 0|=
4 0 0|
5 0 0|
> 6 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 685.7443
P(chi-square) = 0
Total sequences searched: 2059
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K