Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

3 accessions found for Xanthomonas axonopodis pv. citri str. 306  

Data for AE008923  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AE008923.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE008923_3089 CDS_3688884-3687877 133.4 3e-45 1
AE008923_3681 CDS_4405935-4403083 125.2 1.8e-42 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE008923_3089 1/1 140 222 .. 1 85 [] 133.4 3e-45
AE008923_3681 2/2 754 837 .. 1 85 [] 124.3 3.8e-42

Alignments of top-scoring domains:
AE008923_3089: domain 1 of 1, from 140 to 222: score 133.4, E = 3e-45
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+L +VQS+arQ++ na+sl ++ e++++RL ALsraHd
AE008923_3 140 ELNHRVKNSLVMVQSLARQSFTNAGSLGDAQEKLDARLLALSRAHDT 186

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W +Ad+ eL + + a y+++d++R+tl+G++
AE008923_3 187 --LTRENWVSADILELTRDAAALYESHDGQRFTLQGDS 222

AE008923_3681: domain 2 of 2, from 754 to 837: score 124.3, E = 3.8e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+++vVQS+a QT+++++s++ef+ +F++RL+ALsr+++L
AE008923_3 754 ELQHRTRNLITVVQSVAKQTVQTTQSMPEFAVKFDDRLAALSRVQGL 800

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L++s+ ++ ++++Ll++eL++ g+e+d+ Ri+ +GP+
AE008923_3 801 --LSQSDNMPTTIGALLRMELEALGAEpDQKRIVAEGPN 837


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-14 11 0|=
-13 35 0|===
-12 330 0|========================
-11 400 35|==*==========================
-10 608 445|===============================*============
-9 753 1103|====================================================== *
-8 785 1145|========================================================= *
-7 544 769|======================================= *
-6 348 420|========================= *
-5 212 208|==============*=
-4 115 98|======*==
-3 78 45|===*==
-2 38 21|=*=
-1 22 9|*=
0 15 4|*=
1 10 2|*
2 4 0|=
3 0 0|
> 4 4 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4192.9326
P(chi-square) = 0

Total sequences searched: 4312

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: