Crenarchaeota Euryarchaeota Nanoarchaeota
Other Archaea
Classification of phyla is from NCBI page
Search:
54 projects found  

1 accessions found for Methanosarcina acetivorans C2A  

Data for AE010299  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AE010299.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE010299_1599 CDS_1969824-1972484 208.4 8.1e-60 1
AE010299_0542 CDS_645382-649428 206.4 3.3e-59 1
AE010299_2681 CDS_3440454-3438739 204.7 1.1e-58 1
AE010299_0202 CDS_243126-246950 203.3 2.9e-58 1
AE010299_1284 CDS_1590092-1585806 201.8 8.3e-58 1
AE010299_0609 CDS_730311-732335 197.5 1.6e-56 1
AE010299_3921 CDS_4938476-4940665 196.0 4.4e-56 1
AE010299_2708 CDS_3469328-3472513 195.4 6.8e-56 1
AE010299_3451 CDS_4382186-4380273 195.3 7.5e-56 1
AE010299_0745 CDS_881428-885273 193.6 2.4e-55 1
AE010299_3393 CDS_4308671-4306548 193.2 3.1e-55 1
AE010299_1940 CDS_2468460-2465626 192.8 4.1e-55 1
AE010299_0480 CDS_571167-573713 192.3 5.9e-55 1
AE010299_1583 CDS_1941097-1943985 191.4 1.1e-54 1
AE010299_1586 CDS_1948680-1952270 190.4 2.1e-54 2
AE010299_0948 CDS_1157294-1159786 190.3 2.3e-54 1
AE010299_0608 CDS_727859-729823 190.2 2.5e-54 1
AE010299_1829 CDS_2316282-2314594 189.9 3.1e-54 1
AE010299_1239 CDS_1526139-1522072 189.8 3.2e-54 1
AE010299_2028 CDS_2580782-2578686 189.8 3.3e-54 1
AE010299_0744 CDS_877963-881013 188.7 7.2e-54 1
AE010299_0541 CDS_640700-644749 188.0 1.1e-53 1
AE010299_1795 CDS_2276755-2272991 187.7 1.4e-53 1
AE010299_3261 CDS_4132884-4130863 187.4 1.7e-53 1
AE010299_1232 CDS_1512242-1510392 184.9 1e-52 1
AE010299_2205 CDS_2789698-2787656 183.3 3.1e-52 1
AE010299_1423 CDS_1731026-1728993 181.4 1.1e-51 1
AE010299_1430 CDS_1739570-1736370 181.0 1.5e-51 1
AE010299_2813 CDS_3609073-3606416 180.6 1.9e-51 1
AE010299_3285 CDS_4164504-4167884 180.1 2.8e-51 1
AE010299_1600 CDS_1973002-1976178 171.0 1.6e-48 1
AE010299_1584 CDS_1944048-1946747 169.9 3.1e-48 1
AE010299_2657 CDS_3409682-3408138 166.7 3e-47 1
AE010299_1657 CDS_2044315-2042975 164.5 1.4e-46 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE010299_1599 1/1 660 754 .. 1 94 [] 208.4 8.1e-60
AE010299_0542 1/1 1139 1233 .. 1 94 [] 206.4 3.3e-59
AE010299_2681 1/1 345 439 .. 1 94 [] 204.7 1.1e-58
AE010299_0202 1/1 1053 1147 .. 1 94 [] 203.3 2.9e-58
AE010299_1284 1/1 1213 1307 .. 1 94 [] 201.8 8.3e-58
AE010299_0609 1/1 459 547 .. 1 94 [] 197.5 1.6e-56
AE010299_3921 1/1 520 614 .. 1 94 [] 196.0 4.4e-56
AE010299_2708 1/1 839 933 .. 1 94 [] 195.4 6.8e-56
AE010299_3451 1/1 407 501 .. 1 94 [] 195.3 7.5e-56
AE010299_0745 1/1 1079 1167 .. 1 94 [] 193.6 2.4e-55
AE010299_3393 1/1 459 547 .. 1 94 [] 193.2 3.1e-55
AE010299_1940 1/1 741 829 .. 1 94 [] 192.8 4.1e-55
AE010299_0480 1/1 639 727 .. 1 94 [] 192.3 5.9e-55
AE010299_1583 1/1 747 835 .. 1 94 [] 191.4 1.1e-54
AE010299_0948 1/1 605 699 .. 1 94 [] 190.3 2.3e-54
AE010299_0608 1/1 442 530 .. 1 94 [] 190.2 2.5e-54
AE010299_1829 1/1 355 449 .. 1 94 [] 189.9 3.1e-54
AE010299_1239 1/1 1136 1230 .. 1 94 [] 189.8 3.2e-54
AE010299_2028 1/1 489 573 .. 1 94 [] 189.8 3.3e-54
AE010299_1586 2/2 982 1070 .. 1 94 [] 189.7 3.5e-54
AE010299_0744 1/1 814 900 .. 1 94 [] 188.7 7.2e-54
AE010299_0541 1/1 1146 1234 .. 1 94 [] 188.0 1.1e-53
AE010299_1795 1/1 1038 1126 .. 1 94 [] 187.7 1.4e-53
AE010299_3261 1/1 452 546 .. 1 94 [] 187.4 1.7e-53
AE010299_1232 1/1 392 480 .. 1 94 [] 184.9 1e-52
AE010299_2205 1/1 456 547 .. 1 94 [] 183.3 3.1e-52
AE010299_1423 1/1 477 565 .. 1 94 [] 181.4 1.1e-51
AE010299_1430 1/1 835 919 .. 1 94 [] 181.0 1.5e-51
AE010299_2813 1/1 667 755 .. 1 94 [] 180.6 1.9e-51
AE010299_3285 1/1 876 972 .. 1 94 [] 180.1 2.8e-51
AE010299_1600 1/1 841 934 .. 1 94 [] 171.0 1.6e-48
AE010299_1584 1/1 679 772 .. 1 94 [] 169.9 3.1e-48
AE010299_2657 1/1 297 390 .. 1 94 [] 166.7 3e-47
AE010299_1657 1/1 228 315 .. 1 94 [] 164.5 1.4e-46

Alignments of top-scoring domains:
AE010299_1599: domain 1 of 1, from 660 to 754: score 208.4, E = 8.1e-60
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa++fk++e ikd+EVlea+rEsq+RV+
AE010299_1 660 EIHHRIKNNLQVISSLLDLQAEQFKNRENIKDsEVLEAFRESQDRVI 706

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeLYk+++++t++fs+Y+++L+enLfq+y++g+++isL+ Dl
AE010299_1 707 SMALIHEELYKGGGFETLNFSPYIKELVENLFQTYRLGDIDISLNIDL 754

*

AE010299_1 - -

AE010299_0542: domain 1 of 1, from 1139 to 1233: score 206.4, E = 3.3e-59
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf ++e ikd+E+lea+rEsq+RV+
AE010299_0 1139 EIHHRIKNNLQVISSLLDLQAEKFNNREDIKDsEILEAFRESQDRVI 1185

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeLYk++++dt++fs+Y+e+L+enLfq+y++g+ +isLk Dl
AE010299_0 1186 SMALIHEELYKGGGFDTLNFSSYIEELAENLFQTYSLGKADISLKMDL 1233

*

AE010299_0 - -

AE010299_2681: domain 1 of 1, from 345 to 439: score 204.7, E = 1.1e-58
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa++fk++e+ik++EVlea+rEsq RV+
AE010299_2 345 EIHHRIKNNLQVISSLLDLQAEQFKNRECIKNsEVLEAFRESQARVI 391

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeLYk+++l+ ++fs+Y+e+L+++Lf++y+ g+++i+LklDl
AE010299_2 392 SMALIHEELYKGDGLEMLNFSPYIEELAKSLFHTYRIGNSDIRLKLDL 439

*

AE010299_2 - -

AE010299_0202: domain 1 of 1, from 1053 to 1147: score 203.3, E = 2.9e-58
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf ++e ikd+EVlea+rEsq+RV+
AE010299_0 1053 EIHHRIKNNLQVISSLLDLQAEKFNSREDIKDsEVLEAFRESQDRVI 1099

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeLYk++++dt+dfs+Y+e+LtenLf +y++g+ +isL+ Dl
AE010299_0 1100 SMALIHEELYKGGEFDTLDFSSYIEELTENLFLTYRLGNTDISLNMDL 1147

*

AE010299_0 - -

AE010299_1284: domain 1 of 1, from 1213 to 1307: score 201.8, E = 8.3e-58
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf +++ i+++EV +a+rEsq+RV+
AE010299_1 1213 EIHHRIKNNLQVISSLLDLQAEKFGNKKYIMNsEVMDAFRESQDRVI 1259

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeL+kse+ldt++fs+Y+e+L+enLfq+y++g+++i L+ Dl
AE010299_1 1260 SMALIHEELHKSEGLDTLNFSPYIEELAENLFQTYRLGNSNICLNMDL 1307

*

AE010299_1 - -

AE010299_0609: domain 1 of 1, from 459 to 547: score 197.5, E = 1.6e-56
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf+d+ev +ea+rEsqnRV+S
AE010299_0 459 EIHHRIKNNLQVISSLLSLQAEKFEDREV-----IEAFRESQNRVAS 500

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A+iHEeL+ +e+ld++df++Yl+kLt++Lf+sy+vg++g+sLklDl
AE010299_0 501 IAMIHEELHGGENLDSLDFADYLQKLTADLFDSYRVGKEGVSLKLDL 547

AE010299_3921: domain 1 of 1, from 520 to 614: score 196.0, E = 4.4e-56
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf+ +e++ + E+lea++EsqnRV+
AE010299_3 520 EIHHRIKNNLQVISSLLDLQAEKFSHREAVPTlEILEAFKESQNRVI 566

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
Sm+liHEeLYk+e++dt++fs Yl+kL+enLfq+y++ s++i+L Dl
AE010299_3 567 SMSLIHEELYKGEGTDTLNFSVYLRKLAENLFQTYSLCSKNIRLYMDL 614

*

AE010299_3 - -

AE010299_2708: domain 1 of 1, from 839 to 933: score 195.4, E = 6.8e-56
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kfkd+e ikd+EVlea+rEsq+RV+
AE010299_2 839 EIHHRIKNNLQVISSLLDLQAEKFKDREDIKDsEVLEAFRESQDRVI 885

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeL+++e+ld+++fs+Y+++L++nLf +y +g+dg +++ D+
AE010299_2 886 SMALIHEELHRNEGLDKLNFSQYIKELADNLFLTYKLGNDGTRFNKDI 933

*

AE010299_2 - -

AE010299_3451: domain 1 of 1, from 407 to 501: score 195.3, E = 7.5e-56
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf +e ikd+EV ea+rEsq+RV+
AE010299_3 407 EIHHRIKNNLQVISSLLDLQAEKFNKREGIKDsEVMEAFRESQDRVI 453

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeL+ks++ld++dfs+Y+++L++nLf +y++g +++sL+ Dl
AE010299_3 454 SMALIHEELHKSGGLDKLDFSSYIKELADNLFLTYRLGTIDVSLNMDL 501

*

AE010299_3 - -

AE010299_0745: domain 1 of 1, from 1079 to 1167: score 193.6, E = 2.4e-55
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf+d+ev lea+rEsq+RVlS
AE010299_0 1079 EIHHRIKNNLQVISSLLDLQAEKFRDKEV-----LEAFRESQSRVLS 1120

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liHEeLYk+e++dt+df Yl+kL+enLfq+y+ +s++i+L Dl
AE010299_0 1121 MSLIHEELYKGEGTDTLDFPTYLQKLAENLFQTYSFRSKNIRLYMDL 1167

AE010299_3393: domain 1 of 1, from 459 to 547: score 193.2, E = 3.1e-55
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISS+L+LQa+kf+dee+ lea+rEsqnRV S
AE010299_3 459 EIHHRIKNNLQVISSMLSLQAEKFSDEET-----LEAFRESQNRVTS 500

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLY+++d++t+df+ Yl++L+++L++sy+vg+ i+LklDl
AE010299_3 501 MALIHEELYEGKDMETLDFAVYLRRLIGDLLSSYTVGNREIDLKLDL 547

AE010299_1940: domain 1 of 1, from 741 to 829: score 192.8, E = 4.1e-55
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf+d+ev lea+rEsq+R++S
AE010299_1 741 EIHHRIKNNLQVISSLLSLQAEKFRDQEV-----LEAFRESQDRIIS 782

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m liHEeLYk++++dt++fs Y++kLtenLf+ yg++s++i L Dl
AE010299_1 783 MTLIHEELYKGGGTDTLNFSKYIQKLTENLFRIYGLKSKNICLFMDL 829

AE010299_0480: domain 1 of 1, from 639 to 727: score 192.3, E = 5.9e-55
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+L+a+kf+de+ le +rEsqnRV+S
AE010299_0 639 EIHHRIKNNLQVISSLLSLEAEKFSDEKM-----LESFRESQNRVAS 680

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLYk+ +ldt+df++Yl+kLt++Lf+sy++g++gisLklDl
AE010299_0 681 MALIHEELYKGNELDTLDFAAYLQKLTADLFDSYNLGDSGISLKLDL 727

AE010299_1583: domain 1 of 1, from 747 to 835: score 191.4, E = 1.1e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf++++v +ea+rEsqnRV+S
AE010299_1 747 EIHHRIKNNLQVISSLLDLQADKFDNPKV-----IEAFRESQNRVIS 788

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLYk+e+ dt++fs Y+++L++nLfq+y++ s++i L D+
AE010299_1 789 MALIHEELYKGEGNDTLNFSTYIKELAGNLFQTYSLTSKNICLCMDM 835

AE010299_0948: domain 1 of 1, from 605 to 699: score 190.3, E = 2.3e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf++++ i+d+++lea++Esq+RV+
AE010299_0 605 EIHHRIKNNLQVISSLLDLQAEKFRGKKNIEDsKILEAFKESQDRVI 651

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
SmAliHEeL+ks+++dt++fs+Y+ +L +nLf sy++g+dgisL+ D+
AE010299_0 652 SMALIHEELHKSGEIDTLNFSAYIHELSGNLFLSYRLGNDGISLDMDI 699

*

AE010299_0 - -

AE010299_0608: domain 1 of 1, from 442 to 530: score 190.2, E = 2.5e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+L+a+kf+de + lea+rEsqnRV S
AE010299_0 442 EIHHRIKNNLQVISSLLSLEAEKFSDERT-----LEAFRESQNRVVS 483

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLY+++++dt+df+ Yl+kLt +Lf+sy+v+ +++L+lDl
AE010299_0 484 MALIHEELYEGKGMDTIDFAVYLRKLTLDLFNSYTVETRKVRLNLDL 530

AE010299_1829: domain 1 of 1, from 355 to 449: score 189.9, E = 3.1e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQ + f+++e++k++EV+ea+rEsqnRV
AE010299_1 355 EIHHRIKNNLQVISSLLDLQIDIFSNREICKTpEVIEAFRESQNRVV 401

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+AliHEeLYks+++d++df++Yl+kLt+n ++sy+ ++d+i+LklD
AE010299_1 402 SVALIHEELYKSKGMDSLDFAAYLQKLTKNFLKSYNIDADDINLKLDF 449

*

AE010299_1 - -

AE010299_1239: domain 1 of 1, from 1136 to 1230: score 189.8, E = 3.2e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa+kf+++e ++d+EVl+a++Esq RV+
AE010299_1 1136 EIHHRIKNNLQVISSLLDLQAEKFRSREHVEDsEVLNAFKESQERVI 1182

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+AliHEeL++++++dt++fs+Yl++L++nLfq y++g+ +isL+ D+
AE010299_1 1183 SIALIHEELHEGKGTDTLNFSPYLQRLVKNLFQIYNLGNVDISLSMDI 1230

*

AE010299_1 - -

AE010299_2028: domain 1 of 1, from 489 to 573: score 189.8, E = 3.3e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf+d+ev lea+rEsqnRV S
AE010299_2 489 EIHHRIKNNLQVISSLLDLQAEKFRDKEV-----LEAFRESQNRVVS 530

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liHEeLYk+e++d +dfs+Yl+kL e Lfq+y+++s++i+ +
AE010299_2 531 MSLIHEELYKGEGTDALDFSAYLRKLSEKLFQTYSLSSKNIR----M 573

AE010299_1586: domain 2 of 2, from 982 to 1070: score 189.7, E = 3.5e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQ+ISSLL+LQa+kf+d++v ea+rE qnRV+S
AE010299_1 982 EIHHRIKNNLQIISSLLDLQAEKFEDKNV-----TEAFREGQNRVIS 1023

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liHEeLYk+e++dt+dfs Yl+kL+enLfq+y+++s++i+L+ Dl
AE010299_1 1024 MSLIHEELYKGEGTDTLDFSVYLKKLAENLFQTYNLSSKNINLSMDL 1070

AE010299_0744: domain 1 of 1, from 814 to 900: score 188.7, E = 7.2e-54
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf+d++v lea+rEsq+RVlS
AE010299_0 814 EIHHRIKNNLQVISSLLDLQAEKFRDKDV-----LEAFRESQSRVLS 855

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liHEeLYk++++dt+dfs YlekL+enLf++y+ +s++i L+ +
AE010299_0 856 MSLIHEELYKGGETDTLDFSTYLEKLAENLFRTYSFRSKNICLS--M 900

AE010299_0541: domain 1 of 1, from 1146 to 1234: score 188.0, E = 1.1e-53
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf+++ev lea+rEsqnRV S
AE010299_0 1146 EIHHRIKNNLQVISSLLDLQAEKFQNKEV-----LEAFRESQNRVTS 1187

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liHEeLYk+++ t++fs Yl+kL+enLfq+y+++s+++ L Dl
AE010299_0 1188 MSLIHEELYKGGENNTLNFSTYLQKLAENLFQTYSLKSKKVLLCMDL 1234

AE010299_1795: domain 1 of 1, from 1038 to 1126: score 187.7, E = 1.4e-53
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL LQa+kfkd+ev +ea+rEsqnRV+S
AE010299_1 1038 EIHHRIKNNLQVISSLLELQADKFKDREV-----IEAFRESQNRVAS 1079

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA+iHEeLY+ +d++t+dfs+Yl+kLt++L++sy+v++++++Lkl+
AE010299_1 1080 MAIIHEELYRAGDIETLDFSAYLRKLTSDLLSSYTVRKEDVKLKLEA 1126

AE010299_3261: domain 1 of 1, from 452 to 546: score 187.4, E = 1.7e-53
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa++f+ ev+k+++V ea++Esq+RV+
AE010299_3 452 EIHHRIKNNLQVISSLLDLQAENFSKHEVCKTpKVVEAFKESQDRVI 498

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+AliHEeL++++++dt+dfs+YlekL++ Lfq+y++g+ +i Lk +l
AE010299_3 499 SIALIHEELHENGETDTLDFSPYLEKLVDALFQTYRLGNARITLKKEL 546

*

AE010299_3 - -

AE010299_1232: domain 1 of 1, from 392 to 480: score 184.9, E = 1e-52
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa+kf+d+ + + a+rEsqnRV+S
AE010299_1 392 EIHHRIKNNLQVISSLLDLQAEKFEDPTI-----RQAFRESQNRVIS 433

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHEeLY+s++++t++f++Y++kL+en+f++y+ g+++ +L l++
AE010299_1 434 MALIHEELYESGEIGTLNFAAYMQKLVENIFECYNIGDHKAHLHLEI 480

AE010299_2205: domain 1 of 1, from 456 to 547: score 183.3, E = 3.1e-52
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL+LQa++f+d++v +e +++sqnRV+S
AE010299_2 456 EIHHRIKNNLQVISSLLSLQAEYFSDPKV-----KESFKDSQNRVIS 497

mAliHEeLYkse...dldtvdfseYlekLtenLfqsygvgsdgisLklDl
m+liHEeLYk++++ d++t df+ Y++kL+ +Lf+sy vgs++i+LklD+
AE010299_2 498 MSLIHEELYKTRetaDIETFDFKVYIQKLATELFKSYLVGSEDIRLKLDV 547

<-*

AE010299_2 - -

AE010299_1423: domain 1 of 1, from 477 to 565: score 181.4, E = 1.1e-51
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI+HR+KNNLQ++SSLL+LQa++f+d++v +ea+rEs+nR+ S
AE010299_1 477 EINHRIKNNLQIVSSLLDLQAEQFSDKKV-----IEAFRESENRIVS 518

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liHEeLY+s++ld +dfs+Y++kL+++L++sy+ +s++i++klD+
AE010299_1 519 MSLIHEELYESGNLDILDFSSYIRKLIDDLCRSYSTESSHIRIKLDV 565

AE010299_1430: domain 1 of 1, from 835 to 919: score 181.0, E = 1.5e-51
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvISSLL LQa+kf++ ev lea+rEsqnRV++
AE010299_1 835 EIHHRIKNNLQVISSLLELQAEKFDNLEV-----LEAFRESQNRVAT 876

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA+iHEeLY+s++ +t+dfs+Yl+kLt++Lf+sy v+++++ +
AE010299_1 877 MAIIHEELYRSRNNETLDFSAYLQKLTADLFHSYLVRKGDVG----M 919

AE010299_2813: domain 1 of 1, from 667 to 755: score 180.6, E = 1.9e-51
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQ++SSLL+LQa+kfkd++v +ea+rEs+nRV+S
AE010299_2 667 EIHHRIKNNLQIVSSLLSLQADKFKDKDV-----IEAFRESENRVIS 708

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m++iHEeL+ksed+ ++df++Yl+kLt++L+ sy vg++++++ lD+
AE010299_2 709 MSIIHEELHKSEDTTNIDFAAYLRKLTSELLYSYKVGNEKVRFFLDV 755

AE010299_3285: domain 1 of 1, from 876 to 972: score 180.1, E = 2.8e-51
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+LQa kf ++e i+d+EVlea++Esq+RV
AE010299_3 876 EIHHRIKNNLQVISSLLDLQAGKFNNKEHIRDsEVLEAFKESQDRVT 922

SmAliHEeLYkse..dldtvdfseYlekLtenLfqsygvgsdgisLklDl
S+AliHEeL++ e++ +dt++f Yl++L++nLf++y++g+++isL+lDl
AE010299_3 923 SIALIHEELHEEEgkTTDTLNFPIYLQRLVKNLFRTYTLGNIDISLNLDL 972

<-*

AE010299_3 - -

AE010299_1600: domain 1 of 1, from 841 to 934: score 171.0, E = 1.6e-48
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
E HHR+KNNLQvISSLL+LQa+ fk++++i+d+EVl+a++Es++RVl
AE010299_1 841 ELHHRIKNNLQVISSLLDLQADLFKGKKTITDsEVLKAFNESIDRVL 887

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+Al+HEeLYk++++d ++fs+Y+++L++nL+ +y+++ d +sL++Dl
AE010299_1 888 SIALVHEELYKGKNIDLLNFSQYIKELANNLLLTYSLKTD-VSLNFDL 934

*

AE010299_1 - -

AE010299_1584: domain 1 of 1, from 679 to 772: score 169.9, E = 3.1e-48
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQ+ISSLL+LQa+ fk++ i+d+EVl+a+ s +RVl
AE010299_1 679 EIHHRIKNNLQIISSLLDLQAEMFKGRSNIRDsEVLKAFAVSMDRVL 725

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S+AliHEeLYk++++d ++fseY++kL++nL+ +y+++ d ++L+lDl
AE010299_1 726 SIALIHEELYKGKNIDVLNFSEYIKKLADNLLITYRLETD-VNLNLDL 772

*

AE010299_1 - -

AE010299_2657: domain 1 of 1, from 297 to 390: score 166.7, E = 3e-47
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHR+KNNLQvISSLL+L++++ + +++++ ea+rEs+nR++
AE010299_2 297 EIHHRIKNNLQVISSLLDLECDSLLSGTP-DHkKIAEAFRESHNRII 342

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
Sm+ iHEeLY s+d++t++f++Yl+kLt++Lf+sy vg+++i+L lD+
AE010299_2 343 SMSVIHEELYNSRDMETINFASYLKKLTDDLFKSYKVGNSDIKLYLDV 390

*

AE010299_2 - -

AE010299_1657: domain 1 of 1, from 228 to 315: score 164.5, E = 1.4e-46
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI+HR+KNNLQvISSLL+ +a+k++d+e+ lea+rE+qnR++S
AE010299_1 228 EINHRIKNNLQVISSLLSFEAEKSTDPEI-----LEAFRETQNRIAS 269

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liH+eL + ++ t+d+++Yl+kLt+ +f+sy vg+++i+L+lDl
AE010299_1 270 MSLIHQELCIG-ETYTIDLADYLRKLTAGIFSSYLVGNERINLRLDL 315


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-15 4 0|=
-14 16 0|=
-13 55 28|=*==
-12 210 298|============ *
-11 1053 830|==============================================*============
-10 960 1074|====================================================== *
-9 807 907|============================================= *
-8 564 608|================================ *
-7 293 361|================= *
-6 303 201|===========*=====
-5 108 108|=====*
-4 55 57|===*
-3 44 30|=*=
-2 10 15|*
-1 17 8|*
0 3 4|*
1 1 2|*
2 1 1|*
> 3 36 -|==


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 219.5696
P(chi-square) = 5.518e-310

Total sequences searched: 4540

Whole sequence top hits:
tophits_s report:
Total hits: 34
Satisfying E cutoff: 34
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 34
Satisfying E cutoff: 34
Total memory: 35K


Acknowledgements:

This research is funded by:

Developed by: