Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
19 projects found  

2 accessions found for Leptospira interrogans serovar Lai str. 56601  

Data for AE010300  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AE010300.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE010300_0111 CDS_117839-119992 150.9 1.1e-42 1
AE010300_2539 CDS_2524944-2523475 142.6 2.4e-40 1
AE010300_2531 CDS_2511301-2509850 137.0 9e-39 1
AE010300_1036 CDS_1046718-1045339 126.7 7.7e-36 1
AE010300_4123 CDS_4094452-4093319 110.2 4e-31 1
AE010300_4124 CDS_4095787-4094657 98.6 7.8e-28 1
AE010300_1551 CDS_1552282-1550981 97.6 1.5e-27 1
AE010300_2714 CDS_2698225-2697281 96.8 2.6e-27 1
AE010300_2716 CDS_2699834-2698821 94.2 1.3e-26 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE010300_0111 1/1 518 601 .. 1 94 [] 150.9 1.1e-42
AE010300_2539 1/1 296 381 .. 1 94 [] 142.6 2.4e-40
AE010300_2531 1/1 278 364 .. 1 94 [] 137.0 9e-39
AE010300_1036 1/1 266 351 .. 1 94 [] 126.7 7.7e-36
AE010300_4123 1/1 190 273 .. 1 94 [] 110.2 4e-31
AE010300_4124 1/1 188 271 .. 1 94 [] 98.6 7.8e-28
AE010300_1551 1/1 244 328 .. 1 94 [] 97.6 1.5e-27
AE010300_2714 1/1 129 210 .. 1 94 [] 96.8 2.6e-27
AE010300_2716 1/1 152 233 .. 1 94 [] 94.2 1.3e-26

Alignments of top-scoring domains:
AE010300_0111: domain 1 of 1, from 518 to 601: score 150.9, E = 1.1e-42
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISSLL++Q+++++d+ l ++ EsqnR ++
AE010300_0 518 EIHHRVKNNLQVISSLLSMQSDYVQDKQS-----LSVFIESQNRLRT 559

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m++iHEeLY+se+l+++ s Y+ekL+++Lfq yg++++ + l
AE010300_0 560 MSMIHEELYQSENLGKIQYSVYIEKLLNQLFQVYGKSDSVV-----L 601

AE010300_2539: domain 1 of 1, from 296 to 381: score 142.6, E = 2.4e-40
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQv++SLL+LQ++ +e + +L+E+ +R++S
AE010300_2 296 EIHHRVKNNLQVVTSLLSLQSEHYGNERI-----SHILKECGRRIQS 337

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliH+eLY+se++ ++df +Yl+ L+ +L++s+g++++ +++k +
AE010300_2 338 MALIHKELYQSENITKIDFYDYLNTLLVSLLHSFGKEKK-VEFK--I 381

AE010300_2531: domain 1 of 1, from 278 to 364: score 137.0, E = 9e-39
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHRVKNN+Q+++SLL+LQa+++ +++ +++E+ ++L+++++RV
AE010300_2 278 EIHHRVKNNMQIMISLLNLQADNAMSRNL-TAkELYNLLKDTESRVF 323

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
Sm+l+H+eLYks dl+ vdf +Yl+ L+enL+++ygvg + +
AE010300_2 324 SMSLVHNELYKSNDLSHVDFHSYLNMLLENLWNLYGVGLK-------I 364

*

AE010300_2 - -

AE010300_1036: domain 1 of 1, from 266 to 351: score 126.7, E = 7.7e-36
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNL +ISS+ +L + ++++e ++LrEsqnR ++
AE010300_1 266 EIHHRIKNNLTIISSIFSLRSGQTTGES------NDVLRESQNRLRA 306

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE LY+s+dl+ + f Y++kLt+ Lfq y+v +++++L+ l
AE010300_1 307 VALLHEILYESKDLSLISFELYVKKLTDALFQIYQVNREKVRLE--L 351

AE010300_4123: domain 1 of 1, from 190 to 273: score 110.2, E = 4e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRV+NNLQv S+L+ +++++ ++ +++L ++qnR+l+
AE010300_4 190 EIHHRVRNNLQVLSGLVEMHSDSDQGNL------RNILSDFQNRILA 230

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++ +H++LYkse++ ++dfse++e++++nL++ +g++s +i+
AE010300_4 231 ISEVHNYLYKSENYFDIDFSEVIERIIANLIHKFGKQSVKIE----N 273

AE010300_4124: domain 1 of 1, from 188 to 271: score 98.6, E = 7.8e-28
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRV+NNLQvIS+L+ +++ + k+ + +L ++qnR+l+
AE010300_4 188 EIHHRVRNNLQVISGLVEMHSGSGKENL------QIILSDFQNRILA 228

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++ +H++LYkse++ +df e+++k++ nL + g++s++i+ +
AE010300_4 229 ISEVHNYLYKSENYFEIDFVEVMDKIILNLSHRLGKRSIKIE----T 271

AE010300_1551: domain 1 of 1, from 244 to 328: score 97.6, E = 1.5e-27
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI+HRVKNN +I ++L+L +k+++e + ++ + +++R++S
AE010300_1 244 EIQHRVKNNIHLILGMLNLDREKAESELA-----KKTIESAIDRIQS 285

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m +++E+L +++++ + +eYl+ L++++f syg++++ i+ +
AE010300_1 286 MGIVQEYLFLNDSYKVIQTKEYLDTLVNHIFLSYGRQDGSIQ----V 328

AE010300_2714: domain 1 of 1, from 129 to 210: score 96.8, E = 2.6e-27
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRV+NNLQv S+L +L+ r+ k+ +++L E+qnR+l+
AE010300_2 129 EIHHRVRNNLQVLSGLADLH-RNDKSDS------QKILFEFQNRILA 168

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+ +H++LYks+++ +++fs ++ek++enL++ + +++ i l
AE010300_2 169 MSEVHNYLYKSDNYHSIEFSNVIEKIIENLKSKHKDSNVTI-----L 210

AE010300_2716: domain 1 of 1, from 152 to 233: score 94.2, E = 1.3e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRV+NNLQv S+L L+ d + +L E+qnR+l+
AE010300_2 152 EIHHRVRNNLQVLSGLAILHNKDDADL-------QRVLFEFQNRILA 191

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+ +H++LYks+++ +++fs ++ek++enL++ + ++++ i l
AE010300_2 192 MSEVHNYLYKSDNYHSIEFSNVIEKIIENLKSKHKDSKITI-----L 233


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-15 21 0|==
-14 102 0|======
-13 179 27|=*=========
-12 348 286|================*====
-11 980 797|==============================================*===========
-10 710 1031|========================================== *
-9 706 871|========================================== *
-8 508 584|============================== *
-7 289 347|================= *
-6 299 193|===========*======
-5 79 104|===== *
-4 56 55|===*
-3 31 28|=*
-2 19 15|*=
-1 10 7|*
0 3 4|*
1 1 2|*
2 5 1|*
3 0 0|
4 1 0|=
> 5 11 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 1115.7490
P(chi-square) = 0

Total sequences searched: 4358

Whole sequence top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: