Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

2 accessions found for Bifidobacterium longum NCC2705  

Data for AE014295  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AE014295.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE014295_0577 CDS_726643-729219 99.8 1.7e-29 2
AE014295_0551 CDS_693559-694911 72.1 2.5e-21 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE014295_0577 1/2 231 298 .. 1 70 [] 79.6 1.5e-23
AE014295_0551 1/1 215 284 .. 1 70 [] 72.1 2.5e-21

Alignments of top-scoring domains:
AE014295_0577: domain 1 of 2, from 231 to 298: score 79.6, E = 1.5e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HD+v+++Ls i++q+++ r++ + dp+ ar ++++i
AE014295_0 231 ERARIARDMHDVVAHTLSIIIVQSDGGRYAG--THDPAVARNTMETI 275

relarealaevRrllgdLRpaal<-*
r+ +++al ++ rllg++ + +
AE014295_0 276 RHESERALHDMQRLLGVFGGSPH 298

AE014295_0551: domain 1 of 1, from 215 to 284: score 72.1, E = 2.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+RIARE+HD vg+ L+ +++q+++ ++++ ++ +++ a++ +++
AE014295_0 215 ERTRIAREIHDNVGHLLTRAIMQAQAGKTVA--KATNDtVAAQGFAT 259

irelarealaevRrllgdLR.paal<-*
+ +++++a++ vRr ++dL +++++
AE014295_0 260 LGATLDDAMTMVRRSVHDLEdDGTD 284


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 2 0|=
-13 21 0|====
-12 52 19|===*=====
-11 80 158|============== *
-10 238 367|======================================== *
-9 330 417|======================================================= *
-8 270 321|============================================= *
-7 228 202|=================================*====
-6 160 114|==================*========
-5 165 61|==========*=================
-4 59 32|=====*====
-3 41 16|==*====
-2 37 8|=*=====
-1 18 4|*==
0 7 2|*=
1 5 1|*
2 6 0|=
3 1 0|=
4 1 0|=
5 2 0|=
6 0 0|
7 0 0|
> 8 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 519.1130
P(chi-square) = 0

Total sequences searched: 1727

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: