Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Pseudomonas putida KT2440  

Data for AE015451  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AE015451.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE015451_2106 CDS_2426890-2425949 71.8 9.5e-21 2
AE015451_0405 CDS_496127-498514 64.4 1.4e-18 1
AE015451_2645 CDS_3058719-3059993 61.3 1.1e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE015451_2106 2/2 102 166 .. 1 70 [] 71.1 1.5e-20
AE015451_0405 1/1 599 666 .. 1 70 [] 64.4 1.4e-18
AE015451_2645 1/1 229 295 .. 1 70 [] 61.3 1.1e-17

Alignments of top-scoring domains:
AE015451_2106: domain 2 of 2, from 102 to 166: score 71.1, E = 1.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+++ RELHD +gQ L+a+klql++++ ++ p+e++ + d++
AE015451_2 102 ERQHLGRELHDDIGQLLTAAKLQLQWLQ-----RRMPDELQGHCDAL 143

relarealaevRrllgdLRpaal<-*
r +++++l vR++ L p +l
AE015451_2 144 RSTLDDTLGNVRDVSALLNPRQL 166

AE015451_0405: domain 1 of 1, from 599 to 666: score 64.4, E = 1.4e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aRIARE HD++gQ+L+++kl +++++ ++ ++ ++ + ++l+ +
AE015451_0 599 EKARIAREVHDELGQMLTVLKLEVSMCELAY--AELDPGLNDRLASM 643

relarealaevRrllgdLRpaal<-*
++l+ + + vR+++++LRp++l
AE015451_0 644 KRLIAQLFQLVRDVATALRPPIL 666

AE015451_2645: domain 1 of 1, from 229 to 295: score 61.3, E = 1.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +A+ LHD +gQ L++++ ql l+r+++ + pe++ ++++++
AE015451_2 229 ERTQLAQTLHDDLGQYLAGMRAQLCLLRMVA---EQPEMVTQTVQAL 272

relarealaevRrllgdLRpaal<-*
+ +++ ++ R+l+++L p al
AE015451_2 273 ELNCERLQQGFRALVHNLYPVAL 295


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-14 14 0|=
-13 69 0|=====
-12 123 59|===*=====
-11 225 490|=============== *
-10 592 1137|======================================== *
-9 870 1291|==========================================================*
-8 830 995|======================================================== *
-7 755 626|=========================================*=========
-6 585 354|=======================*===============
-5 493 190|============*====================
-4 286 99|======*=============
-3 199 51|===*==========
-2 105 26|=*=====
-1 80 13|*=====
0 46 6|*===
1 25 3|*=
2 15 1|*
3 14 0|=
4 6 0|=
5 3 0|=
6 2 0|=
7 3 0|=
8 0 0|
9 5 0|=
10 1 0|=
11 0 0|
12 0 0|
> 13 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2881.2439
P(chi-square) = 0

Total sequences searched: 5350

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: