Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Leifsonia xyli subsp. xyli str. CTCB07  

Data for AE016822  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AE016822.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE016822_0660 CDS_883753-882641 83.2 1.5e-24 1
AE016822_1161 CDS_1511752-1510439 82.7 2.2e-24 1
AE016822_0564 CDS_753016-751826 62.6 1.9e-18 1
AE016822_1454 CDS_1883911-1884843 47.6 4.8e-14 1
AE016822_0726 CDS_983053-984318 37.2 5.7e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE016822_0660 1/1 160 227 .. 1 70 [] 83.2 1.5e-24
AE016822_1161 1/1 222 289 .. 1 70 [] 82.7 2.2e-24
AE016822_0564 1/1 193 258 .. 1 70 [] 62.6 1.9e-18
AE016822_1454 1/1 114 180 .. 1 70 [] 47.6 4.8e-14
AE016822_0726 1/1 212 280 .. 1 70 [] 37.2 5.7e-11

Alignments of top-scoring domains:
AE016822_0660: domain 1 of 1, from 160 to 227: score 83.2, E = 1.5e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE+HD v++sL++++ +++ +rl+ dk+p++ +e+++++
AE016822_0 160 ERSRIAREMHDIVSHSLTVMIALADGSARLA--DKAPARSAETMRMV 204

relarealaevRrllgdLRpaal<-*
+e++r ala++Rrllg+LR++ +
AE016822_0 205 AETGRSALADMRRLLGVLRTDSD 227

AE016822_1161: domain 1 of 1, from 222 to 289: score 82.7, E = 2.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR++HD+v++sL++++ q+++ar++ +++pe+++eal++i
AE016822_1 222 ERTRIARDMHDVVAHSLAVVIAQADGARYAR--RTAPEAVDEALTTI 266

relarealaevRrllgdLRpaal<-*
+++ar ala+vR ll +LR ++
AE016822_1 267 AATARSALADVRVLLAELRQSQP 289

AE016822_0564: domain 1 of 1, from 193 to 258: score 62.6, E = 1.9e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARELHD+v+Q+Ls+i l l++a+r + +++ +a +a++ +
AE016822_0 193 ERSRLARELHDTVAQGLSSIQLLLHAAERFT--TEP--AALDAVRLA 235

relarealaevRrllgdLRpaal<-*
re+a lae+Rr +++L p+al
AE016822_0 236 RETAAADLAETRRFIHALTPPAL 258

AE016822_1454: domain 1 of 1, from 114 to 180: score 47.6, E = 4.8e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD+v Q+ +++ l le+a++ +d ++ar ++ +
AE016822_1 114 ERHRLAAEIHDTVVQGAASALLLLEAAEQTW---SDRDAARVSIASA 157

relarealaevRrllgdLRpaal<-*
++++r lae+Rrl+++L + l
AE016822_1 158 EQTLRNNLAETRRLVHRLASDSL 180

AE016822_0726: domain 1 of 1, from 212 to 280: score 37.2, E = 5.7e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
R +ARELHD++ ++++i l ++++rr d++p+++ +++ l+
AE016822_0 212 QRDQLARELHDEITNQIAGIVLTTQAVRR----DRPPGdgGLDADLE 254

eirelarealaevRrllgdLR.paal<-*
+i++++ eal+ +Rr +++LR ++++
AE016822_0 255 AIEAAGAEALRRMRRWASALRaHDIE 280


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 11 0|==
-13 35 0|======
-12 52 22|===*=====
-11 103 186|================== *
-10 221 431|===================================== *
-9 339 490|========================================================= *
-8 259 377|============================================ *
-7 276 237|=======================================*======
-6 224 134|======================*===============
-5 228 72|===========*==========================
-4 112 37|======*============
-3 76 19|===*=========
-2 24 9|=*==
-1 24 5|*===
0 17 2|*==
1 15 1|*==
2 4 0|=
3 1 0|=
4 0 0|
5 0 0|
6 1 0|=
7 1 0|=
8 0 0|
> 9 7 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1068.9841
P(chi-square) = 0

Total sequences searched: 2030

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: