Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
19 projects found  

2 accessions found for Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130  

Data for AE016823  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AE016823.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE016823_0096 CDS_116680-118833 150.9 8.3e-43 1
AE016823_1395 CDS_1762262-1763731 142.6 1.9e-40 1
AE016823_1402 CDS_1775899-1777350 137.0 7e-39 1
AE016823_2550 CDS_3177509-3178888 126.7 6e-36 1
AE016823_3195 CDS_4033073-4031940 110.2 3.1e-31 1
AE016823_3196 CDS_4034408-4033278 98.6 6e-28 1
AE016823_2153 CDS_2676330-2677589 97.6 1.2e-27 1
AE016823_1258 CDS_1593266-1594375 94.2 1e-26 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE016823_0096 1/1 518 601 .. 1 94 [] 150.9 8.3e-43
AE016823_1395 1/1 296 381 .. 1 94 [] 142.6 1.9e-40
AE016823_1402 1/1 278 364 .. 1 94 [] 137.0 7e-39
AE016823_2550 1/1 266 351 .. 1 94 [] 126.7 6e-36
AE016823_3195 1/1 190 273 .. 1 94 [] 110.2 3.1e-31
AE016823_3196 1/1 188 271 .. 1 94 [] 98.6 6e-28
AE016823_2153 1/1 230 314 .. 1 94 [] 97.6 1.2e-27
AE016823_1258 1/1 184 265 .. 1 94 [] 94.2 1e-26

Alignments of top-scoring domains:
AE016823_0096: domain 1 of 1, from 518 to 601: score 150.9, E = 8.3e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISSLL++Q+++++d+ l ++ EsqnR ++
AE016823_0 518 EIHHRVKNNLQVISSLLSMQSDYVQDKQS-----LSVFIESQNRLRT 559

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m++iHEeLY+se+l+++ s Y+ekL+++Lfq yg++++ + l
AE016823_0 560 MSMIHEELYQSENLGKIQYSVYIEKLLNQLFQVYGKSDSVV-----L 601

AE016823_1395: domain 1 of 1, from 296 to 381: score 142.6, E = 1.9e-40
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQv++SLL+LQ++ +e + +L+E+ +R++S
AE016823_1 296 EIHHRVKNNLQVVTSLLSLQSEHYGNERI-----SHILKECGRRIQS 337

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliH+eLY+se++ ++df +Yl+ L+ +L++s+g++++ +++k +
AE016823_1 338 MALIHKELYQSENITKIDFYDYLNTLLVSLLHSFGKEKK-VEFK--I 381

AE016823_1402: domain 1 of 1, from 278 to 364: score 137.0, E = 7e-39
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
EIHHRVKNN+Q+++SLL+LQa+++ +++ +++E+ ++L+++++RV
AE016823_1 278 EIHHRVKNNMQIMISLLNLQADNAMSRNL-TAkELYNLLKDTESRVF 323

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
Sm+l+H+eLYks dl+ vdf +Yl+ L+enL+++ygvg + +
AE016823_1 324 SMSLVHNELYKSNDLSHVDFHSYLNMLLENLWNLYGVGLK-------I 364

*

AE016823_1 - -

AE016823_2550: domain 1 of 1, from 266 to 351: score 126.7, E = 6e-36
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNL +ISS+ +L + ++++e ++LrEsqnR ++
AE016823_2 266 EIHHRIKNNLTIISSIFSLRSGQTTGES------NDVLRESQNRLRA 306

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE LY+s+dl+ + f Y++kLt+ Lfq y+v +++++L+ l
AE016823_2 307 VALLHEILYESKDLSLISFELYVKKLTDALFQIYQVNREKVRLE--L 351

AE016823_3195: domain 1 of 1, from 190 to 273: score 110.2, E = 3.1e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRV+NNLQv S+L+ +++++ ++ +++L ++qnR+l+
AE016823_3 190 EIHHRVRNNLQVLSGLVEMHSDSDQGNL------RNILSDFQNRILA 230

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++ +H++LYkse++ ++dfse++e++++nL++ +g++s +i+
AE016823_3 231 ISEVHNYLYKSENYFDIDFSEVIERIIANLIHKFGKQSVKIE----N 273

AE016823_3196: domain 1 of 1, from 188 to 271: score 98.6, E = 6e-28
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRV+NNLQvIS+L+ +++ + k+ + +L ++qnR+l+
AE016823_3 188 EIHHRVRNNLQVISGLVEMHSGSGKENL------QIILSDFQNRILA 228

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++ +H++LYkse++ +df e+++k++ nL + g++s++i+ +
AE016823_3 229 ISEVHNYLYKSENYFEIDFVEVMDKIILNLSHRLGKRSIKIE----T 271

AE016823_2153: domain 1 of 1, from 230 to 314: score 97.6, E = 1.2e-27
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI+HRVKNN +I ++L+L +k+++e + ++ + +++R++S
AE016823_2 230 EIQHRVKNNIHLILGMLNLDREKAESELA-----KKTIESAIDRIQS 271

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m +++E+L +++++ + +eYl+ L++++f syg++++ i+ +
AE016823_2 272 MGIVQEYLFLNDSYKVIQTKEYLDTLVNHIFLSYGRQDGSIQ----V 314

AE016823_1258: domain 1 of 1, from 184 to 265: score 94.2, E = 1e-26
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRV+NNLQv S+L L+ d + +L E+qnR+l+
AE016823_1 184 EIHHRVRNNLQVLSGLAILHNKDDADL-------QRVLFEFQNRILA 223

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+ +H++LYks+++ +++fs ++ek++enL++ + ++++ i l
AE016823_1 224 MSEVHNYLYKSDNYHSIEFSNVIEKIIENLKSKHKDSKITI-----L 265


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-15 1 0|=
-14 12 0|=
-13 44 21|=*==
-12 137 222|=========== *
-11 721 620|===============================================*========
-10 624 803|================================================ *
-9 637 678|================================================= *
-8 464 455|==================================*=
-7 271 270|====================*
-6 276 150|===========*==========
-5 77 81|======*
-4 57 42|===*=
-3 28 22|=*=
-2 17 11|*=
-1 9 6|*
0 3 3|*
1 1 1|*
2 4 0|=
3 0 0|
4 1 0|=
> 5 10 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 230.7022
P(chi-square) = 2.698e-312

Total sequences searched: 3394

Whole sequence top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: