Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

1 accessions found for Chromobacterium violaceum ATCC 12472  

Data for AE016825  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AE016825.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE016825_3259 CDS_3544985-3546439 139.2 2.2e-39 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE016825_3259 1/1 283 371 .. 1 94 [] 139.2 2.2e-39

Alignments of top-scoring domains:
AE016825_3259: domain 1 of 1, from 283 to 371: score 139.2, E = 2.2e-39
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvI+SLL++Q++++++e + + +L++sq RV+S
AE016825_3 283 EVHHRVKNNLQVIISLLNMQTQYVREEST-----RGVLQDSQARVRS 324

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliH+ LY+ d+++vd++eYl++ + L++syg ++g++++lD
AE016825_3 325 MALIHQLLYERHDFSKVDLGEYLQRFNHLLLSSYGQLASGLKVELDA 371


Histogram of all scores:
score obs exp (one = represents 20 sequences)
----- --- ---
-15 8 0|=
-14 29 0|==
-13 71 27|=*==
-12 287 289|==============*
-11 1156 806|========================================*=================
-10 958 1043|================================================ *
-9 695 880|=================================== *
-8 538 591|=========================== *
-7 251 350|============= *
-6 221 195|=========*==
-5 94 105|=====*
-4 46 55|==*
-3 23 29|=*
-2 8 15|*
-1 11 7|*
0 4 4|*
1 2 2|*
2 3 1|*
> 3 2 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 311.9257
P(chi-square) = 0

Total sequences searched: 4407

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: