Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for   

Data for AE017180  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AE017180.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE017180_0677 CDS_716939-718009 60.6 1.2e-17 1
AE017180_3211 CDS_3546226-3544670 55.3 4.6e-16 1
AE017180_1283 CDS_1408577-1409731 51.1 7.5e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE017180_0677 1/1 142 207 .. 1 70 [] 60.6 1.2e-17
AE017180_3211 1/1 288 355 .. 1 70 [] 55.3 4.6e-16
AE017180_1283 1/1 177 241 .. 1 70 [] 51.1 7.5e-15

Alignments of top-scoring domains:
AE017180_0677: domain 1 of 1, from 142 to 207: score 60.6, E = 1.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIA ELHD vgQ+L+++ l+l+ ++ d r+ ++ei
AE017180_0 142 ERSRIAGELHDQVGQNLFLAGLKLGSLKISS--LGD--DDRRVVEEI 184

relarealaevRrllgdLRpaal<-*
r+l+ al+++R l +LRp+ l
AE017180_0 185 RHLIGGALQDIRSLTCQLRPPLL 207

AE017180_3211: domain 1 of 1, from 288 to 355: score 55.3, E = 4.6e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++RELHD +gQ L a+k++ ++++ l + + ++++l +
AE017180_3 288 ERKRLSRELHDDLGQLLNALKIGFDTLAEDL--RQPSHDVQDRLWYL 332

relarealaevRrllgdLRpaal<-*
e ++ ++ +Rrl +L+p++l
AE017180_3 333 SESLNNSIHTIRRLCAGLHPSTL 355

AE017180_1283: domain 1 of 1, from 177 to 241: score 51.1, E = 7.5e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++ +LHD +gQ+L+ +k+ ++ +r ++ +e ++ e+
AE017180_1 177 ERRRLSTDLHDLIGQTLAFAKIRAHSLREHV-----AEDGLTQWGEL 218

relarealaevRrllgdLRpaal<-*
+l++++++evR l+ ++ p++l
AE017180_1 219 TGLLDQSIQEVRSLIFQISPPIL 241


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 29 0|===
-13 57 0|======
-12 99 38|===*=====
-11 152 315|============== *
-10 438 733|======================================== *
-9 639 832|==========================================================*
-8 497 641|============================================== *
-7 427 403|====================================*==
-6 326 228|====================*=========
-5 320 122|===========*==================
-4 146 63|=====*========
-3 121 32|==*========
-2 68 16|=*=====
-1 43 8|*===
0 30 4|*==
1 16 2|*=
2 11 1|*
3 7 0|=
4 4 0|=
5 6 0|=
6 1 0|=
7 4 0|=
8 1 0|=
> 9 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1374.8669
P(chi-square) = 0

Total sequences searched: 3447

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: