Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
7 projects found  

2 accessions found for Thermus thermophilus HB27  

Data for AE017221  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AE017221.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE017221_0815 CDS_801502-799955 91.0 7.6e-27 1
AE017221_0158 CDS_141611-140646 49.2 1.6e-14 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE017221_0815 1/1 318 385 .. 1 70 [] 91.0 7.6e-27
AE017221_0158 1/1 137 197 .. 1 70 [] 49.2 1.6e-14

Alignments of top-scoring domains:
AE017221_0815: domain 1 of 1, from 318 to 385: score 91.0, E = 7.6e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+++QsL+ ++l+l+l++rl +kd ++a al+e+
AE017221_0 318 ERTRIAREIHDGLAQSLAFMALKLDLVERLW--EKDKGAALGALAEV 362

relarealaevRrllgdLRpaal<-*
re++r ++evRr + +LRp +l
AE017221_0 363 RETLRAQIREVRRSIFALRPIDL 385

AE017221_0158: domain 1 of 1, from 137 to 197: score 49.2, E = 1.6e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R RELHD+vg L+a+ l l +a+ + e l e+
AE017221_0 137 ERRRVGRELHDGVGSLLTAALLTLKVAE----------RRPEKLPEA 173

relarealaevRrllgdLR.paal<-*
r+ + eal+evRrl ++LR p +
AE017221_0 174 RARVAEALEEVRRLSQELRmPLLD 197


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 1 0|=
-13 10 0|==
-12 16 22|===*
-11 36 181|====== *
-10 171 421|============================= *
-9 226 478|====================================== *
-8 259 368|============================================ *
-7 300 231|======================================*===========
-6 273 131|=====================*========================
-5 270 70|===========*=================================
-4 147 36|=====*===================
-3 101 18|==*==============
-2 61 9|=*=========
-1 39 4|*======
0 27 2|*====
1 16 1|*==
2 9 0|==
3 8 0|==
4 4 0|=
5 2 0|=
6 0 0|
7 1 0|=
8 1 0|=
9 0 0|
10 1 0|=
11 0 0|
12 0 0|
> 13 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2132.7141
P(chi-square) = 0

Total sequences searched: 1982

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: