hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AE017223.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE017223_0342 CDS_371575-372894 77.1 1e-22 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE017223_0342 1/1 234 301 .. 1 70 [] 77.1 1e-22
Alignments of top-scoring domains:
AE017223_0342: domain 1 of 1, from 234 to 301: score 77.1, E = 1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD+++Q+L +++ ++la r++ ++ + a ++++ +
AE017223_0 234 ERARLARELHDGISQNLVGVRYAIDLASRQV--RTGSGGAPQTIEKA 278
relarealaevRrllgdLRpaal<-*
++++ a++evRrl +dLRp +l
AE017223_0 279 SDALNGAIKEVRRLSHDLRPRIL 301
Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 22 0|====
-13 63 0|===========
-12 89 22|===*===========
-11 105 186|================== *
-10 302 431|=================================================== *
-9 347 490|==========================================================*
-8 300 377|================================================== *
-7 246 237|=======================================*=
-6 181 134|======================*========
-5 157 72|===========*===============
-4 80 37|======*=======
-3 52 19|===*=====
-2 31 9|=*====
-1 33 5|*=====
0 6 2|*
1 6 1|*
2 3 0|=
3 5 0|=
4 0 0|
5 0 0|
> 6 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 745.5281
P(chi-square) = 0
Total sequences searched: 2030
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K