Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
19 projects found  

1 accessions found for Treponema denticola ATCC 35405  

Data for AE017226  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AE017226.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE017226_2363 CDS_2411209-2412357 63.7 1.2e-18 1
AE017226_0148 CDS_169111-169980 32.4 2e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE017226_2363 1/1 184 251 .. 1 70 [] 63.7 1.2e-18
AE017226_0148 1/1 92 157 .. 1 70 [] 32.4 2e-09

Alignments of top-scoring domains:
AE017226_2363: domain 1 of 1, from 184 to 251: score 63.7, E = 1.2e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+RE+HDsvg++Ls +++ql ++ +++ + ++ + + + +
AE017226_2 184 ERNRISREIHDSVGHGLSTMIIQLNALYAAA--KNNNNDLPQKILDL 228

relarealaevRrllgdLRpaal<-*
+ a++ l+evR +l++L+p +
AE017226_2 229 NAFAKKNLEEVRFALRELKPVDY 251

AE017226_0148: domain 1 of 1, from 92 to 157: score 32.4, E = 2e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+ LH s+g++Lsa +lq+ +++++ + ++e l ++
AE017226_0 92 ERNRISGSLHNSIGHTLSAGILQVNALKYIS--NQE--DVKESLNTL 134

relarealaevRrllgdLRpaal<-*
+ ++ +++e+R+ l++++ + +
AE017226_0 135 QNSLENGMTEIRECLHNMHNDSF 157


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-15 11 0|==
-14 101 0|===========
-13 153 0|================
-12 207 30|==*==================
-11 273 253|=========================*==
-10 554 588|======================================================== *
-9 521 668|===================================================== *
-8 364 514|===================================== *
-7 251 323|========================== *
-6 138 183|============== *
-5 109 98|=========*=
-4 30 51|=== *
-3 26 26|==*
-2 10 13|=*
-1 7 6|*
0 4 3|*
> 1 8 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1121.9326
P(chi-square) = 0

Total sequences searched: 2767

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: