Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Propionibacterium acnes KPA171202  

Data for AE017283  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AE017283.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AE017283_0063 CDS_71691-70321 88.1 6.3e-26 1
AE017283_0913 CDS_1008533-1009882 80.1 1.4e-23 1
AE017283_1976 CDS_2200064-2201341 75.1 4.2e-22 1
AE017283_1057 CDS_1169261-1170601 71.8 4.2e-21 1
AE017283_0401 CDS_458331-459497 67.8 6.1e-20 1
AE017283_0283 CDS_340543-339311 55.2 3.2e-16 1
AE017283_0933 CDS_1027485-1026322 49.9 1.1e-14 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AE017283_0063 1/1 254 321 .. 1 70 [] 88.1 6.3e-26
AE017283_0913 1/1 241 308 .. 1 70 [] 80.1 1.4e-23
AE017283_1976 1/1 211 286 .. 1 70 [] 75.1 4.2e-22
AE017283_1057 1/1 235 300 .. 1 70 [] 71.8 4.2e-21
AE017283_0401 1/1 201 268 .. 1 70 [] 67.8 6.1e-20
AE017283_0283 1/1 214 280 .. 1 70 [] 55.2 3.2e-16
AE017283_0933 1/1 183 248 .. 1 70 [] 49.9 1.1e-14

Alignments of top-scoring domains:
AE017283_0063: domain 1 of 1, from 254 to 321: score 88.1, E = 6.3e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IARELHD v++sLs++++q+e+ ++l+ +k pe+a e l++i
AE017283_0 254 TRNEIARELHDIVAHSLSVMIVQAEGGKALA--TKKPEKAPEVLETI 298

relarealaevRrllgdLRpaal<-*
+e++real e+Rr++g+LR +++
AE017283_0 299 AETGREALLEMRRIVGVLRQDTD 321

AE017283_0913: domain 1 of 1, from 241 to 308: score 80.1, E = 1.4e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE+HDs +++ s++ +++ +arr+l d dp+ areal+++
AE017283_0 241 ERLRIAREMHDSMAHHVSVVGIHAAGARRAL--DVDPDLAREALATV 285

relarealaevRrllgdLRpaal<-*
+ +rea +e+R llg LR +++
AE017283_0 286 ESESREAVTEMRSLLGSLRAGDE 308

AE017283_1976: domain 1 of 1, from 211 to 286: score 75.1, E = 4.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrllds..dkdpe....ear
ERa IAR++HD v++sLs+i +q+++ ++l++++++ d e++ ++
AE017283_1 211 ERAKIARDMHDIVAHSLSVIVVQADGGAYLAHHeeAGDIEtrlsASG 257

ealdeirelarealaevRrllgdLRpaal<-*
+ald+i+++ar+al+e+Rrl+g+LR+ +
AE017283_1 258 QALDTIATTARHALDETRRLVGVLRDNDA 286

AE017283_1057: domain 1 of 1, from 235 to 300: score 71.8, E = 4.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HD+v+QsLs+i l l++++r + +++ +a e+++ +
AE017283_1 235 ERARLAREIHDTVAQSLSSIGLLLSAVERTA--PDH--PAIEQIRLA 277

relarealaevRrllgdLRpaal<-*
+ ++++al+e+R l+ +L p++
AE017283_1 278 HLASSDALSETRGLIAELAPPTV 300

AE017283_0401: domain 1 of 1, from 201 to 268: score 67.8, E = 6.1e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ A + HD +gQ+L++++++++la+rl+ +dp++ar+++ e+
AE017283_0 201 EREQVASDVHDLLGQTLTVMAMKAQLAERLI--GTDPDAARAQAVEL 245

relarealaevRrllgdLRpaal<-*
++l r+ala+vR+l++d+ +++
AE017283_0 246 HGLTRRALAQVRELVSDMAHMGV 268

AE017283_0283: domain 1 of 1, from 214 to 280: score 55.2, E = 3.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA+E+HD +g++Ls+++lq+++++++l +++p+ ++ a++e+
AE017283_0 214 ERERIAQEIHDQLGHRLSLLSLQSGALETQL--RDNPDVVK-AAHEV 257

relarealaevRrllgdLRpaal<-*
++ a a +++ ll++L ++
AE017283_0 258 QAGAAAAVNDLHSLLSVLTESRV 280

AE017283_0933: domain 1 of 1, from 183 to 248: score 49.9, E = 1.1e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +A ELHD+v+ L++i++ ++ +r +++e + +a + i
AE017283_0 183 ERQQLAAELHDVVAKDLTVITMLAGSLRL----NTANEDVITASKSI 225

relarealaevRrllgdLRpaal<-*
+ ++r al+++ rll +LR l
AE017283_0 226 ENTSRAALDDLQRLLLVLRNRNL 248


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 4 0|=
-13 27 0|====
-12 52 25|===*====
-11 131 210|=================== *
-10 308 488|============================================ *
-9 388 554|======================================================== *
-8 353 427|=================================================== *
-7 332 268|======================================*=========
-6 222 152|=====================*==========
-5 207 81|===========*==================
-4 107 42|=====*==========
-3 55 21|==*=====
-2 40 11|=*====
-1 31 5|*====
0 15 2|*==
1 10 1|*=
2 2 0|=
3 1 0|=
4 3 0|=
> 5 9 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 760.4872
P(chi-square) = 0

Total sequences searched: 2297

Whole sequence top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: