Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

1 accessions found for Dehalococcoides sp. CBDB1  

Data for AJ965256  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AJ965256.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AJ965256_0869 CDS_847644-843955 67.9 3.6e-20 1
AJ965256_0317 CDS_327249-326176 57.5 4.3e-17 1
AJ965256_0539 CDS_532213-531068 56.6 7.8e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AJ965256_0869 1/1 1023 1087 .. 1 70 [] 67.9 3.6e-20
AJ965256_0317 1/1 147 214 .. 1 70 [] 57.5 4.3e-17
AJ965256_0539 1/1 171 238 .. 1 70 [] 56.6 7.8e-17

Alignments of top-scoring domains:
AJ965256_0869: domain 1 of 1, from 1023 to 1087: score 67.9, E = 3.6e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHD vgQsL+++kl+l+ a+ d+ p++ ++ l+e+
AJ965256_0 1023 ERATIARELHDQVGQSLTVLKLMLDKAK-----DSLPDRSEKLLAEA 1064

relarealaevRrllgdLRpaal<-*
+ l++e ++ vR++ dLRp l
AJ965256_0 1065 QPLVSELISSVRNMSLDLRPRML 1087

AJ965256_0317: domain 1 of 1, from 147 to 214: score 57.5, E = 4.3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+RELHD+v+ L +++ +++ + ++ ++d + + +ld++
AJ965256_0 147 ERKRISRELHDEVAPLLLLLMQKIDNLSKQS--ERDIADCKPQLDAL 191

relarealaevRrllgdLRpaal<-*
r+ ++eal+ +Rr+++dLRp +l
AJ965256_0 192 RTQSEEALESLRRIAQDLRPRIL 214

AJ965256_0539: domain 1 of 1, from 171 to 238: score 56.6, E = 7.8e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ER+RIA+ELHD +Q L +i+ +++ +k+p ++ ++l
AJ965256_0 171 ERRRIAQELHDDTAQDLIVISRAIDRFV-----TKNPNlgeDNLAEL 212

deirelarealaevRrllgdLRpaal<-*
+e++ +++++l+evRr ++dLRp++l
AJ965256_0 213 EEMQNHINRTLSEVRRFAQDLRPSVL 238


Histogram of all scores:
score obs exp (one = represents 5 sequences)
----- --- ---
-14 28 0|======
-13 64 0|=============
-12 84 16|===*=============
-11 99 133|==================== *
-10 269 310|====================================================== *
-9 285 352|========================================================= *
-8 211 271|=========================================== *
-7 155 170|=============================== *
-6 92 96|===================*
-5 61 51|==========*==
-4 38 27|=====*==
-3 26 13|==*===
-2 16 7|=*==
-1 9 3|*=
0 7 1|*=
1 4 0|=
2 2 0|=
3 1 0|=
4 0 0|
> 5 7 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 351.5632
P(chi-square) = 0

Total sequences searched: 1458

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: