Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Sinorhizobium meliloti 1021  

Data for AL591688  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AL591688.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AL591688_2434 CDS_2623166-2621661 142.5 1.8e-48 1
AL591688_0242 CDS_274729-276447 124.7 2.1e-42 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AL591688_2434 1/1 315 397 .. 1 85 [] 142.5 1.8e-48
AL591688_0242 1/1 376 458 .. 1 85 [] 124.7 2.1e-42

Alignments of top-scoring domains:
AL591688_2434: domain 1 of 1, from 315 to 397: score 142.5, E = 1.8e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+ QS+arQTlR++ +++ef++aF+gRLqA s+aH+L
AL591688_2 315 ELNHRVKNTLAMLQSLARQTLRQTSDPAEFMTAFAGRLQAISEAHGL 361

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++ eW+ +L+eL++ +L Py ++++++++l+ ++
AL591688_2 362 --LSDYEWGTIHLSELISKQLLPYVSDYSQQVELHKDE 397

AL591688_0242: domain 1 of 1, from 376 to 458: score 124.7, E = 2.1e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HR KN+L+v+QS+ +Q++++a+++ +fveaF+ RL+ L+r+ dL
AL591688_0 376 EVAHRAKNQLTVIQSMLAQSANSAEEPSDFVEAFRKRLAGLARSTDL 422

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++ ++g+d+reL++ +L+P++++ ++R++lsGP+
AL591688_0 423 --MVANAASGVDFRELVRNQLQPFMPAESDRVVLSGPA 458


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-15 1 0|=
-14 3 0|=
-13 39 0|====
-12 272 0|=========================
-11 354 27|==*==============================
-10 528 345|===============================*================
-9 583 855|===================================================== *
-8 599 887|======================================================= *
-7 381 596|=================================== *
-6 225 325|===================== *
-5 148 161|==============*
-4 92 76|======*==
-3 49 35|===*=
-2 29 16|=*=
-1 18 7|*=
0 7 3|*
1 6 1|*
2 2 0|=
3 1 0|=
> 4 4 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4328.7915
P(chi-square) = 0

Total sequences searched: 3341

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: