Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Sinorhizobium meliloti 1021  

Data for AL591985  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AL591985.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AL591985_0496 CDS_537727-541212 160.0 9.4e-55 1
AL591985_1056 CDS_1157697-1160420 134.8 3.6e-46 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AL591985_0496 1/1 970 1052 .. 1 85 [] 160.0 9.4e-55
AL591985_1056 1/1 717 799 .. 1 85 [] 134.8 3.6e-46

Alignments of top-scoring domains:
AL591985_0496: domain 1 of 1, from 970 to 1052: score 160.0, E = 9.4e-55
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLAvVQS+arQTlR+++s+++fve+F+gRL+AL++aH L
AL591985_0 970 ELSHRVKNTLAVVQSLARQTLRTTRSSEDFVERFEGRLAALASAHKL 1016

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++seW+gA+L +L++ +L++y+g d++R++++G++
AL591985_0 1017 --LVDSEWRGAELDALARGQLDAYAGSDRRRLQIEGEP 1052

AL591985_1056: domain 1 of 1, from 717 to 799: score 134.8, E = 3.6e-46
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+V SiarQT+ + ++ ++++++F++R++AL+++H
AL591985_1 717 ELSHRVKNTLAIVGSIARQTFSTNPDAKAAHRSFDARIRALAQTHTR 763

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L +++W+g++L+ +l eL+Py+++ ++ +tl GP+
AL591985_1 764 --LAEASWSGVSLKTVLFDELSPYHDDSRTNVTLAGPP 799


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-15 1 0|=
-14 2 0|=
-13 16 0|===
-12 126 0|=====================
-11 121 12|=*===================
-10 274 162|==========================*===================
-9 272 401|============================================== *
-8 298 417|================================================== *
-7 187 280|================================ *
-6 117 152|==================== *
-5 64 75|=========== *
-4 35 35|=====*
-3 28 16|==*==
-2 12 7|=*
-1 6 3|*
0 4 1|*
1 2 0|=
2 2 0|=
> 3 3 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 1116.1576
P(chi-square) = 0

Total sequences searched: 1570

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: