Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

3 accessions found for Streptomyces coelicolor A3(2)  

Data for AL645882  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AL645882.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AL645882_3376 CDS_3754484-3753279 102.5 1.3e-29 1
AL645882_1059 CDS_1132338-1131091 100.9 3.7e-29 1
AL645882_3742 CDS_4130995-4129649 97.4 3.9e-28 1
AL645882_2153 CDS_2331562-2330312 92.8 8.9e-27 1
AL645882_3105 CDS_3421340-3420021 89.1 1.1e-25 1
AL645882_4109 CDS_4537897-4536527 88.8 1.4e-25 1
AL645882_2294 CDS_2475740-2476969 88.7 1.4e-25 1
AL645882_5666 CDS_6186588-6187784 88.6 1.5e-25 1
AL645882_3639 CDS_4033367-4032042 88.5 1.6e-25 1
AL645882_5116 CDS_5578902-5580068 87.2 3.9e-25 1
AL645882_6344 CDS_7022727-7024016 87.1 4.4e-25 1
AL645882_3626 CDS_4019882-4018503 86.7 5.8e-25 1
AL645882_3624 CDS_4017806-4016388 86.0 9.3e-25 1
AL645882_6145 CDS_6767325-6766414 85.9 9.3e-25 1
AL645882_4347 CDS_4775642-4776853 83.3 5.4e-24 1
AL645882_6121 CDS_6740466-6741632 81.4 2e-23 1
AL645882_1732 CDS_1863882-1865048 80.2 4.5e-23 1
AL645882_6648 CDS_7409680-7408463 79.9 5.5e-23 1
AL645882_5767 CDS_6321291-6322367 79.9 5.6e-23 1
AL645882_1790 CDS_1930823-1929645 79.0 1e-22 1
AL645882_1247 CDS_1329747-1330901 77.8 2.3e-22 1
AL645882_7628 CDS_8477246-8476050 77.2 3.5e-22 1
AL645882_0410 CDS_440190-438997 75.7 1e-21 1
AL645882_1357 CDS_1445966-1447180 74.8 1.8e-21 1
AL645882_4260 CDS_4690823-4692109 74.0 3e-21 1
AL645882_5438 CDS_5939275-5940603 73.5 4.2e-21 1
AL645882_2202 CDS_2378415-2379692 73.5 4.4e-21 1
AL645882_6401 CDS_7090613-7091761 71.0 2.3e-20 1
AL645882_4652 CDS_5097181-5098476 69.7 5.6e-20 1
AL645882_2505 CDS_2714775-2713432 69.2 8.2e-20 1
AL645882_7068 CDS_7877241-7876048 69.0 9.2e-20 1
AL645882_5807 CDS_6373869-6375023 68.8 1e-19 1
AL645882_2346 CDS_2527817-2526699 67.7 2.2e-19 1
AL645882_6404 CDS_7094609-7093614 67.7 2.3e-19 1
AL645882_4058 CDS_4467921-4466674 67.0 3.6e-19 1
AL645882_6235 CDS_6875083-6876336 63.5 3.9e-18 1
AL645882_5362 CDS_5849063-5847867 63.4 4.1e-18 1
AL645882_2439 CDS_2638132-2639559 61.5 1.5e-17 1
AL645882_0192 CDS_194637-192880 55.8 7.2e-16 1
AL645882_3211 CDS_3536945-3538660 55.5 8.6e-16 1
AL645882_3735 CDS_4121462-4120212 55.2 1.1e-15 1
AL645882_3933 CDS_4347161-4348843 54.8 1.4e-15 1
AL645882_4582 CDS_5022045-5020678 54.1 2.3e-15 1
AL645882_4583 CDS_5023382-5022159 53.5 3.4e-15 1
AL645882_7690 CDS_8546786-8548315 53.5 3.5e-15 1
AL645882_6250 CDS_6894022-6893258 38.6 8.2e-11 1
AL645882_0200 CDS_201374-202090 38.2 1.1e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AL645882_3376 1/1 190 257 .. 1 70 [] 102.5 1.3e-29
AL645882_1059 1/1 207 274 .. 1 70 [] 100.9 3.7e-29
AL645882_3742 1/1 223 291 .. 1 70 [] 97.4 3.9e-28
AL645882_2153 1/1 194 261 .. 1 70 [] 92.8 8.9e-27
AL645882_3105 1/1 207 274 .. 1 70 [] 89.1 1.1e-25
AL645882_4109 1/1 244 311 .. 1 70 [] 88.8 1.4e-25
AL645882_2294 1/1 211 278 .. 1 70 [] 88.7 1.4e-25
AL645882_5666 1/1 194 262 .. 1 70 [] 88.6 1.5e-25
AL645882_3639 1/1 225 292 .. 1 70 [] 88.5 1.6e-25
AL645882_5116 1/1 186 253 .. 1 70 [] 87.2 3.9e-25
AL645882_6344 1/1 218 285 .. 1 70 [] 87.1 4.4e-25
AL645882_3626 1/1 229 298 .. 1 70 [] 86.7 5.8e-25
AL645882_3624 1/1 263 330 .. 1 70 [] 86.0 9.3e-25
AL645882_6145 1/1 110 174 .. 1 70 [] 85.9 9.3e-25
AL645882_4347 1/1 209 277 .. 1 70 [] 83.3 5.4e-24
AL645882_6121 1/1 184 250 .. 1 70 [] 81.4 2e-23
AL645882_1732 1/1 184 251 .. 1 70 [] 80.2 4.5e-23
AL645882_6648 1/1 193 260 .. 1 70 [] 79.9 5.5e-23
AL645882_5767 1/1 153 217 .. 1 70 [] 79.9 5.6e-23
AL645882_1790 1/1 194 261 .. 1 70 [] 79.0 1e-22
AL645882_1247 1/1 190 255 .. 1 70 [] 77.8 2.3e-22
AL645882_7628 1/1 188 255 .. 1 70 [] 77.2 3.5e-22
AL645882_0410 1/1 183 250 .. 1 70 [] 75.7 1e-21
AL645882_1357 1/1 193 260 .. 1 70 [] 74.8 1.8e-21
AL645882_4260 1/1 207 274 .. 1 70 [] 74.0 3e-21
AL645882_5438 1/1 239 304 .. 1 70 [] 73.5 4.2e-21
AL645882_2202 1/1 234 301 .. 1 70 [] 73.5 4.4e-21
AL645882_6401 1/1 174 241 .. 1 70 [] 71.0 2.3e-20
AL645882_4652 1/1 238 303 .. 1 70 [] 69.7 5.6e-20
AL645882_2505 1/1 227 300 .. 1 70 [] 69.2 8.2e-20
AL645882_7068 1/1 186 254 .. 1 70 [] 69.0 9.2e-20
AL645882_5807 1/1 194 263 .. 1 70 [] 68.8 1e-19
AL645882_2346 1/1 186 251 .. 1 70 [] 67.7 2.2e-19
AL645882_6404 1/1 130 194 .. 1 70 [] 67.7 2.3e-19
AL645882_4058 1/1 211 278 .. 1 70 [] 67.0 3.6e-19
AL645882_6235 1/1 215 282 .. 1 70 [] 63.5 3.9e-18
AL645882_5362 1/1 190 255 .. 1 70 [] 63.4 4.1e-18
AL645882_2439 1/1 302 368 .. 1 70 [] 61.5 1.5e-17
AL645882_0192 1/1 378 443 .. 1 70 [] 55.8 7.2e-16
AL645882_3211 1/1 193 259 .. 1 70 [] 55.5 8.6e-16
AL645882_3735 1/1 226 293 .. 1 70 [] 55.2 1.1e-15
AL645882_3933 1/1 359 424 .. 1 70 [] 54.8 1.4e-15
AL645882_4582 1/1 260 327 .. 1 70 [] 54.1 2.3e-15
AL645882_4583 1/1 204 271 .. 1 70 [] 53.5 3.4e-15
AL645882_7690 1/1 168 234 .. 1 70 [] 53.5 3.5e-15
AL645882_6250 1/1 58 121 .. 1 70 [] 38.6 8.2e-11
AL645882_0200 1/1 36 102 .. 1 70 [] 38.2 1.1e-10

Alignments of top-scoring domains:
AL645882_3376: domain 1 of 1, from 190 to 257: score 102.5, E = 1.3e-29
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v+++ s++ +q+++a+++l d++p++a++al++i
AL645882_3 190 ERARIARELHDVVAHNVSVMVVQADGAAYVL--DAAPDQAKKALETI 234

relarealaevRrllgdLRpaal<-*
++r+alae+Rrllg+LR++++
AL645882_3 235 SSTGRQALAEMRRLLGVLRTGEH 257

AL645882_1059: domain 1 of 1, from 207 to 274: score 100.9, E = 3.7e-29
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD++++s+s+i++q+++ ++ll d+dpe+ar+al++i
AL645882_1 207 ERLRIARELHDVLAHSISVINVQAGVGLALL--DTDPEQARTALTTI 251

relarealaevRrllgdLRpaal<-*
++ ++eal evR++l +LR++++
AL645882_1 252 KDQSKEALGEVRQVLDTLRTPGD 274

AL645882_3742: domain 1 of 1, from 223 to 291: score 97.4, E = 3.9e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v++++s+i++q+++a+++l ++ p+ +re+++ i
AL645882_3 223 ERARIARELHDVVAHHMSVITVQADTAEYRL--AALPPDVREEFTSI 267

relarealaevRrllgdLR.paal<-*
+++are+l e+Rrllg+LR++ a+
AL645882_3 268 AATARESLGEMRRLLGVLRnEEAH 291

AL645882_2153: domain 1 of 1, from 194 to 261: score 92.8, E = 8.9e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v+++++++++q+++a +++ dk p++a+eal+ +
AL645882_2 194 ERLRIARDLHDVVAHHIALVNVQAGVASHVM--DKRPDQAKEALAHV 238

relarealaevRrllgdLRpaal<-*
re++r al+e+R+++g LR +++
AL645882_2 239 REASRSALDELRATVGLLRQSGD 261

AL645882_3105: domain 1 of 1, from 207 to 274: score 89.1, E = 1.1e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v+++ s++ +++ ++++++ +kdpe+a + ++ +
AL645882_3 207 ERTRIAREMHDVVAHRVSLMVVHAAALQAIA--RKDPEKAVKNAALV 251

relarealaevRrllgdLRpaal<-*
+++r+al+e+R++lg+LR ++
AL645882_3 252 GDMGRQALTELREMLGVLRSGGG 274

AL645882_4109: domain 1 of 1, from 244 to 311: score 88.8, E = 1.4e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD +g++Ls+i+ +++ r+++ +k p++a++ald+i
AL645882_4 244 ERARIAREMHDIIGHNLSVITGLADGGRYAA--AKSPDRAAQALDAI 288

relarealaevRrllgdLRpaal<-*
+++r+al e+Rrll +LR+++
AL645882_4 289 GTTSRQALGELRRLLDVLRDDDQ 311

AL645882_2294: domain 1 of 1, from 211 to 278: score 88.7, E = 1.4e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R +R+LHD +g++Ls+i +++e+arrl+ ++d ++a ++++ i
AL645882_2 211 ERLRFSRDLHDLLGHTLSVIVVKSEAARRLA--PRDLDAALTQITDI 255

relarealaevRrllgdLRpaal<-*
+ +r+al+evR++++++R++ l
AL645882_2 256 ESVGRQALTEVREAVTGYREGSL 278

AL645882_5666: domain 1 of 1, from 194 to 262: score 88.6, E = 1.5e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHD v++s s+i++q+e a + + + +ear+ +++i
AL645882_5 194 ERAAIARELHDIVSHSVSMIAVQAESATYTT--PGLTPEARDGFQQI 238

relarealaevRrllgdLR.paal<-*
+++ar ++ae+Rrllg+LR+p+++
AL645882_5 239 AATARSSMAELRRLLGVLRtPQGE 262

AL645882_3639: domain 1 of 1, from 225 to 292: score 88.5, E = 1.6e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++++++i++q++lar ++ ++d+ ar+ald+i
AL645882_3 225 ERVRIARELHDVVAHHIAVINVQAGLARFVF--RSDARTARDALDTI 269

relarealaevRrllgdLRpaal<-*
++++ ealae+Rr+lg LR ++
AL645882_3 270 EGASGEALAELRRMLGLLRADGV 292

AL645882_5116: domain 1 of 1, from 186 to 253: score 87.2, E = 3.9e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+AR+LHD +g+sLs+i+l++ela r+l +++p++a+++++ i
AL645882_5 186 ERLRLARDLHDLLGHSLSLITLKSELAGRML--PAHPDKAAQQVADI 230

relarealaevRrllgdLRpaal<-*
++ +r+al +vR++++++R a l
AL645882_5 231 EQVSRQALVDVREAVTGYRRARL 253

AL645882_6344: domain 1 of 1, from 218 to 285: score 87.1, E = 4.4e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R ARE+HD vg++Ls+i+ +++ ++++ d +pe+ +eal+ i
AL645882_6 218 ERTRVAREMHDIVGHNLSVIITLADAGAYAT--DVAPERGKEALRLI 262

relarealaevRrllgdLRpaal<-*
+++r+al e+Rr+lg+LR+a++
AL645882_6 263 GDTGRQALGELRRVLGVLREAGD 285

AL645882_3626: domain 1 of 1, from 229 to 298: score 86.7, E = 5.8e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++++s+i++q+++a l+ + + +e++e l+ i
AL645882_3 229 ERGRIARELHDVVAHHMSVISIQAQVAPLLV--ENPSDELKENLAGI 273

relarealaevRrllgdLR..paal<-*
r+ a eal+e+Rr+lg+LR+++++l
AL645882_3 274 RQNALEALTELRRVLGVLRseHPDL 298

AL645882_3624: domain 1 of 1, from 263 to 330: score 86.0, E = 9.3e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD+v++++s++++q+e+a +++ + +pee+++a+++i
AL645882_3 263 ERTTIARELHDVVAHHMSVVAIQAEAAPYRV--ENPPEELERAFATI 307

relarealaevRrllgdLRpaal<-*
re a al+e+Rr+lg+ R +
AL645882_3 308 RENAVAALTELRRVLGVVRAEDY 330

AL645882_6145: domain 1 of 1, from 110 to 174: score 85.9, E = 9.3e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA+ELHD+vgQs++ai l l++a+ d++ e++r++l+++
AL645882_6 110 ERRRIAQELHDEVGQSMTAILLVLGRAA-----DDAEEPLRDELHQA 151

relarealaevRrllgdLRpaal<-*
+e+ re+l+evRrl+++LRp++l
AL645882_6 152 QEITRESLDEVRRLVRRLRPGVL 174

AL645882_4347: domain 1 of 1, from 209 to 277: score 83.3, E = 5.4e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+ HD++++sL++i++qlela +lld + d e++rea + +
AL645882_4 209 ERGRIARDVHDVLAHSLAGINMQLELADALLD-TGDLEKVREATTKA 254

relarealaevRrllgdLRpaal<-*
++l++e+l+++ ++++LR++al
AL645882_4 255 QGLVKESLKQAQWTVHALREDAL 277

AL645882_6121: domain 1 of 1, from 184 to 250: score 81.4, E = 2e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v ++ +a+ +q+e+ar+l+ ++pe+++e l+++
AL645882_6 184 ERTRIARELHDVVTHHVTAMVVQSEAARYLT---AAPERLDESLAAV 227

relarealaevRrllgdLRpaal<-*
+++r+a++++R+ll L p+
AL645882_6 228 SDTGRRAITDLRHLLDLLNPDHG 250

AL645882_1732: domain 1 of 1, from 184 to 251: score 80.2, E = 4.5e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD v++s +++ +++ +ar +l ++dp+ a+e+l+ +
AL645882_1 184 ERTAIARELHDIVAHSVTVMLIGVRGARDVL--PTDPGVAAETLEPV 228

relarealaevRrllgdLRpaal<-*
+ a+++lae+Rr+lg LR+++
AL645882_1 229 EVNAEQSLAELRRILGLLRTPDN 251

AL645882_6648: domain 1 of 1, from 193 to 260: score 79.9, E = 5.5e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HD ++++ s++ +q+e+ ++ ++dp++a++a+d+i
AL645882_6 193 ERARIARDMHDILAHAVSLMVVQAEAGPVVV--RSDPARAEAAFDAI 237

relarealaevRrllgdLRpaal<-*
++++r+a++++Rr+lg+L++ +
AL645882_6 238 ATAGRDAMTQLRRILGVLKEEER 260

AL645882_5767: domain 1 of 1, from 153 to 217: score 79.9, E = 5.6e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+vgQ+L+a+ lql +++ d+ p+e+r++++ +
AL645882_5 153 ERHRIARELHDEVGQTLTAVLLQLKRVA-----DRVPGELRDEVTLA 194

relarealaevRrllgdLRpaal<-*
+e+ r +l+e+Rr++++LRp++l
AL645882_5 195 QEATRAGLDEIRRIARRLRPGVL 217

AL645882_1790: domain 1 of 1, from 194 to 261: score 79.0, E = 1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+A ELHD v+Q L++++l +++a +l+ d+dp++a+++l+++
AL645882_1 194 ERSRLAHELHDAVSQKLFSLRLTAQAATALV--DRDPARAKDELHQV 238

relarealaevRrllgdLRpaal<-*
++la ea +e+R+++ +LRpaal
AL645882_1 239 ATLAAEAADELRAAVVELRPAAL 261

AL645882_1247: domain 1 of 1, from 190 to 255: score 77.8, E = 2.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHDs+g++L+++ +q+++ar+ + pe ++al++i
AL645882_1 190 ERTRIARELHDSIGHALTVAVVQAGAARA----ANSPEFTDRALTAI 232

relarealaevRrllgdLRpaal<-*
+e++r al+++ r+lg+LR+a+
AL645882_1 233 EETGRAALEDLERVLGVLREAER 255

AL645882_7628: domain 1 of 1, from 188 to 255: score 77.2, E = 3.5e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++++++s++++q++++ ++ d ++e r ++ i
AL645882_7 188 ERNRIAREMHDVLAHRISLVAMQAGVLDHRG--DLSADENRVLVHGI 232

relarealaevRrllgdLRpaal<-*
+e a++al+e+R++lg+LR +
AL645882_7 233 AEGAHQALEELREVLGVLRAGPG 255

AL645882_0410: domain 1 of 1, from 183 to 250: score 75.7, E = 1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++++++++ q+++a++l+ +++pe+a e l+ +
AL645882_0 183 ERIRIARELHDVVAHHMALANAQASTAAHLA--RTHPEQAHEILTHL 227

relarealaevRrllgdLRpaal<-*
++ al+e+ +++g LR +++
AL645882_0 228 TGTTASALRELKATVGLLRSPDD 250

AL645882_1357: domain 1 of 1, from 193 to 260: score 74.8, E = 1.8e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q+Ls+i l l +a+r+l ++ p+ a+ ++ ++
AL645882_1 193 ERERLAREIHDTLAQGLSSIQLLLRAAERAL--PERPGTAAGHVVAA 237

relarealaevRrllgdLRpaal<-*
r++a ++lae+Rr + +L p+al
AL645882_1 238 RRAAVDSLAEARRFVAALTPPAL 260

AL645882_4260: domain 1 of 1, from 207 to 274: score 74.0, E = 3e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++ E+HDs++Q+Ls+ ++ l++a+r+ ++d ++ar++++ +
AL645882_4 207 ERQRLSMEIHDSLAQGLSSQRMLLQAAERVW--ESDQDKARAHVRGA 251

relarealaevRrllgdLRpaal<-*
+ a++ lae+Rr ++dL pa+l
AL645882_4 252 ASVAEHNLAEARRFVHDLAPADL 274

AL645882_5438: domain 1 of 1, from 239 to 304: score 73.5, E = 4.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD+++Q+L++i+ ql+++++ + dp+ re+ld++
AL645882_5 239 ERRRLAAEIHDTLAQGLTGIIAQLQVVAA----APDPALGREHLDRA 281

relarealaevRrllgdLRpaal<-*
+lar++l e+Rr +++L p al
AL645882_5 282 LALARHSLGEARRSVHNLSPVAL 304

AL645882_2202: domain 1 of 1, from 234 to 301: score 73.5, E = 4.4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ + l+++++ll +kdpe+are l+++
AL645882_2 234 ELRRIERDLHDGAQARLVAMGMDLGTIEALL--EKDPEKARELLAQA 278

relarealaevRrllgdLRpaal<-*
r+ + +al+e+R+l+++++p++l
AL645882_2 279 RRSSADALTELRELVRGIHPPVL 301

AL645882_6401: domain 1 of 1, from 174 to 241: score 71.0, E = 2.3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHDs+ +s+s +klq+++a +l+ +k +e+ al +i
AL645882_6 174 ERLRIARELHDSLTHSISIVKLQAGVAVHLA--RKRGDEVPPALLAI 218

relarealaevRrllgdLRpaal<-*
+e++ ea++e+R +l++LR ++
AL645882_6 219 QEASGEAMRELRSALQVLRADEP 241

AL645882_4652: domain 1 of 1, from 238 to 303: score 69.7, E = 5.6e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a+++ l+lar d++p++++++l+ +
AL645882_4 238 ERRRIERDLHDGAQQRLVALTMALGLARL----DAPPGPLADQLAKA 280

relarealaevRrllgdLRpaal<-*
++ a +al+e+R+l+++++p +l
AL645882_4 281 HGEAGRALEELRELIHGIHPKVL 303

AL645882_2505: domain 1 of 1, from 227 to 300: score 69.2, E = 8.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.....eare
ER R AR+LHD +++s+++i +q+++a+++l ++dpe+ +++++++
AL645882_2 227 ERLRVARDLHDLLAHSITLIGVQTSVAAHVL--TADPErldreAVAK 271

aldeirelarealaevRrllgdLR.paal<-*
ald i+e++r a e+R +l +LR+ ++
AL645882_2 272 ALDDIAETCRSARGELRTTLEVLRgQDTA 300

AL645882_7068: domain 1 of 1, from 186 to 254: score 69.0, E = 9.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++L++++ q+++a++l+ +++p++a ++ +
AL645882_7 186 ERMRIARELHDVVAHHLALANAQAGTAAHLA--RTHPDQAIVMIEKL 230

relarealaevRrllgdLR.paal<-*
+ al+e+ +++g LR++++
AL645882_7 231 PDVTASALRELKATVGLLRqETDA 254

AL645882_5807: domain 1 of 1, from 194 to 263: score 68.8, E = 1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ERaRIARE+HD++++sLsa +++le+ar l+ ++d++++++ +++
AL645882_5 194 ERARIAREIHDVLAHSLSAQMVHLEAARLLI--ERDADrqQILDRVV 238

eirelarealaevRrllgdLRpaal<-*
++r++ar++lae+R++l++LR +
AL645882_5 239 AARGMARDGLAETRQALSALRGDLT 263

AL645882_2346: domain 1 of 1, from 186 to 251: score 67.7, E = 2.2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+v Q+L a+ + l++arr d+d + ++ l ++
AL645882_2 186 ERRRIERDLHDGVQQRLVALGMLLGRARRSQ--DAD--RRDRLLGQA 228

relarealaevRrllgdLRpaal<-*
++ +r+al+e+R++++++ p++l
AL645882_2 229 HDESRRALDELREVAWRIYPTTL 251

AL645882_6404: domain 1 of 1, from 130 to 194: score 67.7, E = 2.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R A+EL D+vgQ+L+a+ l l +++ d +pee+re+l ++
AL645882_6 130 ERHRVAQELYDEVGQTLAAVLLDLKRVA-----DQAPEEVREQLSQV 171

relarealaevRrllgdLRpaal<-*
+e+ r +l+e+Rr++++L p++l
AL645882_6 172 QETTRASLDEIRRIARRLLPGVL 194

AL645882_4058: domain 1 of 1, from 211 to 278: score 67.0, E = 3.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R R+LHD+ g +L++i+l++ela +l ++ +ea e++ e+
AL645882_4 211 ERLRFGRDLHDVMGRNLAVIALKSELAVQLS--RRGRPEAVEQMIEV 255

relarealaevRrllgdLRpaal<-*
+++a+e+++evR++++++R+aal
AL645882_4 256 QRIAQESQREVRDVVRGYREAAL 278

AL645882_6235: domain 1 of 1, from 215 to 282: score 63.5, E = 3.9e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IARE+HD+++++L+++++++++++ + d++ +e+++a+ i
AL645882_6 215 AREAIAREMHDVLAHRLTLLSVHAGALEFRP--DAPRAEVARAAGVI 259

relarealaevRrllgdLRpaal<-*
re a+eal+++R+++g+LR a+
AL645882_6 260 RESAHEALQDLRQIIGVLRAADS 282

AL645882_5362: domain 1 of 1, from 190 to 255: score 63.4, E = 4.1e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARELHD v+ +Lsai++++ +a+ l d++ r+al i
AL645882_5 190 ERSRMARELHDMVANHLSAIAIHSTAALSLD--DAA--TTRQALGVI 232

relarealaevRrllgdLRpaal<-*
re + +lae+Rrl+g LR+++
AL645882_5 233 RENSVAGLAEMRRLIGILRDQGG 255

AL645882_2439: domain 1 of 1, from 302 to 368: score 61.5, E = 1.5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a ++le rr + ++ +r+ l ++
AL645882_2 302 DRDRIARDLHDLVVQRLFATGMMLESTRR----RPGADDVRDILGRA 344

relarealaevRrllgdLR.paal<-*
e +r + evR ++ +L++p+a
AL645882_2 345 VEELRSTVGEVRTAILTLQqPPAG 368

AL645882_0192: domain 1 of 1, from 378 to 443: score 55.8, E = 7.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD Q+L+a + l+ a r++ +++ +a e++ ++
AL645882_0 378 DRDRIARDLHDLAIQRLFATGMTLQSAGRRV--QDP--MASERILRA 420

relarealaevRrllgdLRpaal<-*
+ ++e+++ +R ++ +LR ++
AL645882_0 421 VDDLDETIKIIRSTIFGLRSRDD 443

AL645882_3211: domain 1 of 1, from 193 to 259: score 55.5, E = 8.6e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA+++HDs+g+ Ls+++l +++++ l+ + ++ re + ++
AL645882_3 193 ERARIAQDIHDSLGHELSVMALLAGGLE-LA--PGLSDPHRESVGQL 236

relarealaevRrllgdLRpaal<-*
re + a + + +++g LR++
AL645882_3 237 RERCTMATERLHEVIGLLREDPN 259

AL645882_3735: domain 1 of 1, from 226 to 293: score 55.2, E = 1.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R LHD+ +L ++++ l++arr++ ++dp+ a+e l+++
AL645882_3 226 ELRRIERSLHDGAQNRLVSVTVLLGAARRMA--ARDPAGADELLERA 270

relarealaevRrllgdLRpaal<-*
+ +a++alae+R++++++ p++l
AL645882_3 271 QSAAEQALAELRQVARGILPPVL 293

AL645882_3933: domain 1 of 1, from 359 to 424: score 54.8, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a ++le a+r ++ +e+r+ + +
AL645882_3 359 DRDRIARDLHDLVIQRLFATGMMLESAQR----GSAVPEVRDGVGGA 401

relarealaevRrllgdLRpaal<-*
+ ++ +++e+R ++ +L+ +a+
AL645882_3 402 VDELDVTIQEIRSAIFALQQPAE 424

AL645882_4582: domain 1 of 1, from 260 to 327: score 54.1, E = 2.3e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+RI R+LHD+ +L +++ l+la+ l ++dp +a+ + e+
AL645882_4 260 DLRRIERDLHDGAQARLVNLAMDLGLAKEKL--KEDPRAAAVMVGEA 304

relarealaevRrllgdLRpaal<-*
++ +++al+e+R+l+++++pa+l
AL645882_4 305 HGEVKTALQELRDLARGIHPAVL 327

AL645882_4583: domain 1 of 1, from 204 to 271: score 53.5, E = 3.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+RI R+LHD+ +L ++++l+la+ l +dp++a++ +de+
AL645882_4 204 DLRRIERDLHDGAQARLVNLAMGLGLAKEKL--LEDPDAAAAMVDEA 248

relarealaevRrllgdLRpaal<-*
++ ++ al+e+R+l+++++pa+l
AL645882_4 249 HGEVKLALQELRDLARGIHPAVL 271

AL645882_7690: domain 1 of 1, from 168 to 234: score 53.5, E = 3.5e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA+++HD++g+ Ls+i+l +++++ l+ ++ +e ++a++ i
AL645882_7 168 ERTRIAQDMHDVLGHDLSLIALSAGALK-LA--PDLAEHHQRAAADI 211

relarealaevRrllgdLRpaal<-*
r+ a a + + +++g+LR+ +
AL645882_7 212 RARAAGAVERLGEVIGVLREETG 234

AL645882_6250: domain 1 of 1, from 58 to 121: score 38.6, E = 8.2e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE HD++g +Ls ++ ++el ++ + +ld++
AL645882_6 58 ERRRLAREVHDELGTALSTAAHHIELHAAET-------GGTPHLDAA 97

relarealaevRrllgdLR.paal<-*
r+ +rea+a +Rrl g+L+ ++l
AL645882_6 98 RHSLREAMAVARRLTGELQaQTVL 121

AL645882_0200: domain 1 of 1, from 36 to 102: score 38.2, E = 1.1e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R IAR+ HD v Q+L+a +l + a+ ++ + p +a e+++++
AL645882_0 36 ARDGIARDVHDLVIQRLFAGALSPQPALGRV--TGRP-KASERIQRV 79

relarealaevRrllgdLRpaal<-*
+ ++++++ +R ++++LR+++
AL645882_0 80 VADLDDTIKVIRSTIHALRESDR 102


Histogram of all scores:
score obs exp (one = represents 20 sequences)
----- --- ---
-14 15 0|=
-13 53 1|*==
-12 120 86|====*=
-11 181 712|========== *
-10 656 1652|================================= *
-9 1128 1876|========================================================= *
-8 1113 1445|======================================================== *
-7 1059 909|=============================================*=======
-6 999 514|=========================*========================
-5 971 275|=============*===================================
-4 502 143|=======*==================
-3 343 74|===*==============
-2 240 37|=*==========
-1 123 19|*======
0 76 9|*===
1 54 4|*==
2 26 2|*=
3 20 1|*
4 16 0|=
5 6 0|=
6 5 0|=
7 4 0|=
8 2 0|=
9 3 0|=
10 1 0|=
11 0 0|
12 2 0|=
13 0 0|
14 1 0|=
15 0 0|
> 16 50 -|===


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 7566.2593
P(chi-square) = 0

Total sequences searched: 7825

Whole sequence top hits:
tophits_s report:
Total hits: 47
Satisfying E cutoff: 47
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 47
Satisfying E cutoff: 47
Total memory: 37K


Acknowledgements:

This research is funded by:

Developed by: