Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

2 accessions found for Ralstonia solanacearum GMI1000  

Data for AL646052  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AL646052.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AL646052_0021 CDS_26082-24619 71.9 5.6e-21 1
AL646052_0191 CDS_212253-213629 68.2 6.9e-20 1
AL646052_2309 CDS_2511607-2512758 65.8 3.4e-19 1
AL646052_0289 CDS_321920-323344 63.5 1.7e-18 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AL646052_0021 1/1 249 327 .. 1 70 [] 71.9 5.6e-21
AL646052_0191 1/1 251 320 .. 1 70 [] 68.2 6.9e-20
AL646052_2309 1/1 180 248 .. 1 70 [] 65.8 3.4e-19
AL646052_0289 1/1 247 314 .. 1 70 [] 63.5 1.7e-18

Alignments of top-scoring domains:
AL646052_0021: domain 1 of 1, from 249 to 327: score 71.9, E = 5.6e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
ERaR +RELHD+++Q L + kl le+a+ +l + +p++ ++++ +
AL646052_0 249 ERARVSRELHDGISQVLVSTKLLLETAHGHL--EPPPGhatppgapa 293

..earealdeirelarealaevRrllgdLRpaal<-*
+++a+ l+++ + ++ al evRr+ ++LRpa l
AL646052_0 294 tdKAAGMLRRALDRLNGALGEVRRVSHNLRPALL 327

AL646052_0191: domain 1 of 1, from 251 to 320: score 68.2, E = 6.9e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RIARELHD +gQ+Lsa+k+ ++l+++ l +++ +++ + ++ +
AL646052_0 251 ERHRIARELHDDLGQRLSALKMDISLLAADL--QAEGGdrTLIAQTE 295

eirelarealaevRrllgdLRpaal<-*
++++ ++e+++ vR++ dLRp+ l
AL646052_0 296 AMQRVIDETISAVRQISADLRPPLL 320

AL646052_2309: domain 1 of 1, from 180 to 248: score 65.8, E = 3.4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+ ELHD++gQ+L+++kl +e a+ +++ + + ea+e l ++
AL646052_2 180 ERKRISAELHDGLGQALTLVKLTVEDALIHIH-RNNITEAAELLNTA 225

relarealaevRrllgdLRpaal<-*
+re++ ++Rr+ ++LRpa l
AL646052_2 226 VLRIRESIGDLRRICSELRPALL 248

AL646052_0289: domain 1 of 1, from 247 to 314: score 63.5, E = 1.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +R+ARELHD++g L+a k+ l+++r ++ + +++++ ++++
AL646052_0 247 EKTRLARELHDELGALLTATKMDLHWLRSRI--TVSEPAVADKITRV 291

relarealaevRrllgdLRpaal<-*
+++++++++ Rrl+ dLRp++l
AL646052_0 292 MAHVDQGIQIKRRLIEDLRPTIL 314


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 11 0|==
-13 43 0|=====
-12 75 38|===*====
-11 140 315|============== *
-10 395 731|======================================== *
-9 556 830|======================================================== *
-8 526 640|===================================================== *
-7 469 402|========================================*======
-6 373 227|======================*===============
-5 334 122|============*=====================
-4 181 63|======*============
-3 126 32|===*=========
-2 75 16|=*======
-1 59 8|*=====
0 23 4|*==
1 23 2|*==
2 12 1|*=
3 2 0|=
4 5 0|=
5 3 0|=
6 0 0|
7 1 0|=
8 2 0|=
9 1 0|=
10 0 0|
11 0 0|
12 1 0|=
> 13 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1849.3986
P(chi-square) = 0

Total sequences searched: 3441

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: