hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AL954747.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AL954747_1738 CDS_1873895-1875391 65.9 2.5e-19 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AL954747_1738 1/1 289 356 .. 1 70 [] 65.9 2.5e-19
Alignments of top-scoring domains:
AL954747_1738: domain 1 of 1, from 289 to 356: score 65.9, E = 2.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD +g +L+aik l ++ + pe r ++++
AL954747_1 289 ERTRIAREIHDDIGGTLTAIKCELVPCLDNS--SRTPEFYRNKAEAV 333
relarealaevRrllgdLRpaal<-*
+ l++ ++ +Rr++ dLRp++l
AL954747_1 334 ESLVDMVIDSTRRIALDLRPGVL 356
Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 3 0|=
-13 40 0|=====
-12 71 27|===*=====
-11 133 225|================= *
-10 370 523|=============================================== *
-9 448 594|======================================================== *
-8 406 458|=================================================== *
-7 332 287|===================================*======
-6 220 162|====================*=======
-5 194 87|==========*==============
-4 93 45|=====*======
-3 54 23|==*====
-2 41 11|=*====
-1 27 6|*===
0 13 3|*=
1 12 1|*=
> 2 4 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 580.9164
P(chi-square) = 0
Total sequences searched: 2574
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K