Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

5 accessions found for Xanthomonas campestris pv. vesicatoria str. 85-10  

Data for AM039952  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AM039952.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM039952_3267 CDS_3735329-3734094 130.6 2.7e-44 1
AM039952_3849 CDS_4435437-4431898 127.1 4.4e-43 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM039952_3267 1/1 216 298 .. 1 85 [] 130.6 2.7e-44
AM039952_3849 2/2 983 1066 .. 1 85 [] 126.1 9.2e-43

Alignments of top-scoring domains:
AM039952_3267: domain 1 of 1, from 216 to 298: score 130.6, E = 2.7e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+L +VQS+arQ++ na+ l+++ e++++RL ALsraHd
AM039952_3 216 ELNHRVKNSLVMVQSLARQSFTNAGGLADAQEKLDARLLALSRAHDT 262

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W +Ad+ eL + + a y+++d++R+tl+G++
AM039952_3 263 --LTRENWVSADILELTRDAAALYESHDSQRFTLQGDS 298

AM039952_3849: domain 2 of 2, from 983 to 1066: score 126.1, E = 9.2e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+++vVQS+a QT++ ++s++ef+++F++RL+ALsr+++L
AM039952_3 983 ELQHRTRNLITVVQSVAKQTVQASQSMPEFAAKFEDRLAALSRVQGL 1029

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L++s+ ++ ++++Ll++eL++ g+e+d++Ri+++GP+
AM039952_3 1030 --LSQSDNMPTTIGALLRMELDALGAEpDQRRIVVEGPN 1066


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-14 14 0|=
-13 57 0|=====
-12 344 0|=========================
-11 445 36|==*=============================
-10 630 464|=================================*===========
-9 776 1148|======================================================== *
-8 776 1192|======================================================== *
-7 544 800|======================================= *
-6 345 437|========================= *
-5 228 216|===============*=
-4 129 102|=======*==
-3 75 47|===*==
-2 64 21|=*===
-1 31 10|*==
0 11 4|*
1 8 2|*
2 5 0|=
3 0 0|
4 2 0|=
> 5 3 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 5121.7817
P(chi-square) = 0

Total sequences searched: 4487

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: