Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Brucella melitensis biovar Abortus 2308  

Data for AM040264  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AM040264.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM040264_0369 CDS_367895-369262 77.1 1.1e-22 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM040264_0369 1/1 250 317 .. 1 70 [] 77.1 1.1e-22

Alignments of top-scoring domains:
AM040264_0369: domain 1 of 1, from 250 to 317: score 77.1, E = 1.1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD+++Q+L +++ ++la r++ ++ + a ++++ +
AM040264_0 250 ERARLARELHDGISQNLVGVRYAIDLASRQV--RTGSGGAPQTIEKA 294

relarealaevRrllgdLRpaal<-*
++++ a++evRrl +dLRp +l
AM040264_0 295 SDALNGAIKEVRRLSHDLRPRIL 317


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 20 0|====
-13 48 0|========
-12 87 22|===*===========
-11 105 183|================== *
-10 302 425|=================================================== *
-9 344 482|==========================================================*
-8 292 372|================================================= *
-7 245 234|======================================*==
-6 183 132|=====================*=========
-5 157 71|===========*===============
-4 79 37|======*=======
-3 54 19|===*=====
-2 30 9|=*===
-1 34 4|*=====
0 6 2|*
1 6 1|*
2 2 0|=
3 3 0|=
4 0 0|
5 0 0|
> 6 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 590.9149
P(chi-square) = 0

Total sequences searched: 2186

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: