Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Brucella melitensis biovar Abortus 2308  

Data for AM040265  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AM040265.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM040265_0652 CDS_643410-642019 142.0 9.5e-49 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM040265_0652 1/1 259 341 .. 1 85 [] 142.0 9.5e-49

Alignments of top-scoring domains:
AM040265_0652: domain 1 of 1, from 259 to 341: score 142.0, E = 9.5e-49
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E HR+KN++A+VQSia+QTlRn+ +++++++ Fs RL+ALs+aHd+
AM040265_0 259 EIAHRFKNSMAMVQSIANQTLRNTYDPEQANRLFSERLRALSQAHDM 305

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++WagA++ ++++ +LaP+++ a Ri++sGP+
AM040265_0 306 --LLKENWAGATIQQICATALAPFNSTFANRIHMSGPH 341


Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-15 2 0|=
-14 7 0|==
-13 20 0|=====
-12 99 0|=========================
-11 102 8|=*========================
-10 179 106|==========================*==================
-9 178 264|============================================= *
-8 178 274|============================================= *
-7 106 184|=========================== *
-6 67 100|================= *
-5 45 49|============*
-4 21 23|=====*
-3 16 10|==*=
-2 10 5|=*=
> -1 4 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 1199.3480
P(chi-square) = 0

Total sequences searched: 1164

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: