Crenarchaeota Euryarchaeota Nanoarchaeota
Other Archaea
Classification of phyla is from NCBI page
Search:
82 projects found  

1 accessions found for uncultured methanogenic archaeon RC-I  

Data for AM114193  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AM114193.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM114193_3033 CDS_3120603-3118435 172.9 2.7e-49 1
AM114193_2864 CDS_2942326-2943798 169.8 2.4e-48 1
AM114193_1277 CDS_1278322-1280886 161.7 6.1e-46 1
AM114193_2322 CDS_2356936-2355884 159.1 3.5e-45 1
AM114193_1879 CDS_1895685-1893859 155.3 4.2e-44 1
AM114193_1638 CDS_1643241-1644740 152.5 2.5e-43 1
AM114193_2717 CDS_2786103-2789138 151.8 4.2e-43 1
AM114193_0940 CDS_937446-935596 151.7 4.4e-43 1
AM114193_1306 CDS_1308214-1310238 151.6 4.6e-43 1
AM114193_2533 CDS_2588154-2586250 149.4 2e-42 1
AM114193_2822 CDS_2894266-2892338 140.6 6.4e-40 1
AM114193_3022 CDS_3109034-3107241 128.2 2.1e-36 1
AM114193_0923 CDS_917924-915999 125.1 1.6e-35 1
AM114193_2530 CDS_2581102-2582898 123.8 3.8e-35 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM114193_3033 1/1 517 602 .. 1 94 [] 172.9 2.7e-49
AM114193_2864 1/1 298 386 .. 1 94 [] 169.8 2.4e-48
AM114193_1277 1/1 661 748 .. 1 94 [] 161.7 6.1e-46
AM114193_2322 1/1 157 245 .. 1 94 [] 159.1 3.5e-45
AM114193_1879 1/1 409 495 .. 1 94 [] 155.3 4.2e-44
AM114193_1638 1/1 311 397 .. 1 94 [] 152.5 2.5e-43
AM114193_2717 1/1 815 901 .. 1 94 [] 151.8 4.2e-43
AM114193_0940 1/1 421 508 .. 1 94 [] 151.7 4.4e-43
AM114193_1306 1/1 483 571 .. 1 94 [] 151.6 4.6e-43
AM114193_2533 1/1 436 519 .. 1 94 [] 149.4 2e-42
AM114193_2822 1/1 448 532 .. 1 94 [] 140.6 6.4e-40
AM114193_3022 1/1 405 491 .. 1 94 [] 128.2 2.1e-36
AM114193_0923 1/1 451 540 .. 1 94 [] 125.1 1.6e-35
AM114193_2530 1/1 400 469 .. 1 75 [. 123.8 3.8e-35

Alignments of top-scoring domains:
AM114193_3033: domain 1 of 1, from 517 to 602: score 172.9, E = 2.7e-49
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLL+LQ+ ++kd+ l ++EsqnRV+S
AM114193_3 517 EIHHRVKNNLQIISSLLNLQSGYIKDKQS-----LGMFKESQNRVRS 558

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s+d+ ++df+eY+++Lt+nL++syg g+ ++Lk +
AM114193_3 559 MALIHEKLYQSKDIARIDFAEYIKNLTGNLIRSYGTGAP-VRLK--I 602

AM114193_2864: domain 1 of 1, from 298 to 386: score 169.8, E = 2.4e-48
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQv+SSLL++Q+r+++d++ e+++E qnRV++
AM114193_2 298 EIHHRVKNNLQVVSSLLNIQSRYVTDPDD-----AELFKEGQNRVQA 339

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LY+s dl ++dfs+Y++ L +nLf sy++g+d+i L+ D+
AM114193_2 340 MALVHEKLYQSSDLARIDFSSYIDSLMKNLFYSYALGRDNIVLNTDI 386

AM114193_1277: domain 1 of 1, from 661 to 748: score 161.7, E = 6.1e-46
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ++SSLL+LQ+ +de++ +++++EsqnR++S
AM114193_1 661 EVHHRVKNNLQIVSSLLNLQSNALRDEKI-----RAVFQESQNRIRS 702

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s+dl++vdfs+Yl+ L +L + y++ s+ i+L++D+
AM114193_1 703 MALIHEKLYRSDDLSRVDFSDYLRVLSTDLYRVYADPSK-IRLSVDC 748

AM114193_2322: domain 1 of 1, from 157 to 245: score 159.1, E = 3.5e-45
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLL+LQ+ ++kd l +++++qnRV+S
AM114193_2 157 EIHHRVKNNLQIISSLLNLQSAYIKDDRD-----LHIFKDCQNRVRS 198

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LY+se+l+++df+eY++ L++ L +syg + i+++lD+
AM114193_2 199 MALVHEKLYRSESLSKIDFGEYVRSLAGTLYNSYGATQEQIRFDLDI 245

AM114193_1879: domain 1 of 1, from 409 to 495: score 155.3, E = 4.2e-44
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLL+LQa ++ e + +a+ EsqnR++S
AM114193_1 409 EIHHRVKNNLQIISSLLSLQAGTSSKESA------AAFTESQNRIRS 449

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s +l+++df+ Y++ L ++L +sy+ g + is++ D+
AM114193_1 450 MALIHEKLYQSSNLSRIDFGGYVSGLMSHLVKSYAPGPG-ISVDIDI 495

AM114193_1638: domain 1 of 1, from 311 to 397: score 152.5, E = 2.5e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++SSL++LQ++ ++ e+ +a++Esq+R++S
AM114193_1 311 EIHHRVKNNLQIVSSLISLQSEVATPENM-----TAAFKESQDRIRS 352

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA+iHE+LY+ +dl +vdf+eYl++Lt++L++sy+ + ++++ +
AM114193_1 353 MAMIHERLYRARDLAKVDFGEYLRNLTSYLKSSYQPRTAEVQID--V 397

AM114193_2717: domain 1 of 1, from 815 to 901: score 151.8, E = 4.2e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+I+SLL+LQ + +d+++ aL Esq+R++S
AM114193_2 815 EVHHRVKNNLQIITSLLNLQMSQMQDPDT-----VTALTESQSRIRS 856

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LY+s+dl+++df++Yl+ L+++ +ygv + i+++ +
AM114193_2 857 MALLHEKLYQSKDLSSIDFGDYLRGLISSAYCTYGVNEGLIRVE--I 901

AM114193_0940: domain 1 of 1, from 421 to 508: score 151.7, E = 4.4e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLL+LQa ++++e + +rEsq+R+++
AM114193_0 421 EIHHRVKNNLQIISSLLSLQAGSITGESL-----DKKFRESQDRIRT 462

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s+dl+ +df eY+ Lt++L +sy g++ ++++lD+
AM114193_0 463 MALIHEKLYQSKDLSHIDFEEYVGSLTGYLSRSYVAGGN-VRIDLDI 508

AM114193_1306: domain 1 of 1, from 483 to 571: score 151.6, E = 4.6e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+I+SLL+LQ+ +d++ r+sqnR++S
AM114193_1 483 EVHHRVKNNLQIITSLLNLQSTGMDDPKY-----TGMIRDSQNRIKS 524

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LYks+dl+++d++eYl+ L++n+ +sy+ s+++ L+ D+
AM114193_1 525 MALVHEQLYKSRDLSNIDIAEYLNSLINNISRSYNQASGRVTLRTDI 571

AM114193_2533: domain 1 of 1, from 436 to 519: score 149.4, E = 2e-42
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+++SLL+LQ+ + +d++ ++a++E++nRV+S
AM114193_2 436 EVHHRVKNNLQIVTSLLSLQSAYLSDQKS-----IDAFNETRNRVMS 477

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s+dl ++dfseY++ L++++ +y+ +++ +
AM114193_2 478 MALIHEKLYRSRDLARIDFSEYIQMLASQISTTYSMKGNVA-----M 519

AM114193_2822: domain 1 of 1, from 448 to 532: score 140.6, E = 6.4e-40
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNN+QvISS+L LQ+ ++ d++ +++ r++qnR++S
AM114193_2 448 EIHHRVKNNMQVISSMLELQTAYINDRHL-----IDIIRDCQNRIKS 489

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s +l v+fs Y++ L++nL+ sy+ ++d+i+ +
AM114193_2 490 MALIHEKLYQSNNLAYVNFSVYISSLISNLLGSYRNQRDHIK----I 532

AM114193_3022: domain 1 of 1, from 405 to 491: score 128.2, E = 2.1e-36
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNN+Q+ISSLL+L ++ e v + +L Esq+R++S
AM114193_3 405 EVHHRVKNNMQIISSLLNLRLSGIDQEPV-----RQILAESQSRIRS 446

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al+HE+ Y+s+dl++++f+eYl+ L ++L+ +y+ s++++L +
AM114193_3 447 IALVHERIYMSDDLSKINFDEYLKSLGNQLLVTYRANSGRVRLT--I 491

AM114193_0923: domain 1 of 1, from 451 to 540: score 125.1, E = 1.6e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+++SLL+LQ kd++ ++rEsqnR++S
AM114193_0 451 EVHHRVKNNLQIVTSLLNLQVSDLKDPHD-----VSIFRESQNRIRS 492

mAliHEeLYksedldtvdfseYlekLtenLfqs.ygvgsdgisLklDl<-
+Al+HE Y+s+dl++vdf+ Y e Lt +L q+ +g ++ ++L +D
AM114193_0 493 IALVHESIYQSDDLSRVDFGRYAESLTWQLYQTfHGQLNQQVRLTVDA 540

*

AM114193_0 - -

AM114193_2530: domain 1 of 1, from 400 to 469: score 123.8, E = 3.8e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSL +LQ ++e++ ++ L+EsqnR++S
AM114193_2 400 EIHHRVKNNLQIISSLMNLQISTMTNEAA-----RASLKESQNRIKS 441

mAliHEeLYksedldtvdfseYlekLte<-*
mAliHE+LY s+dl ++df+ Y+ +L++
AM114193_2 442 MALIHEQLYLSRDLASIDFKGYVANLIS 469


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-15 3 0|=
-14 8 0|=
-13 50 19|=*==
-12 163 202|============ *
-11 824 564|========================================*==================
-10 644 730|============================================== *
-9 547 616|======================================== *
-8 387 413|============================ *
-7 188 245|============== *
-6 128 136|=========*
-5 58 73|=====*
-4 24 39|==*
-3 29 20|=*=
-2 6 10|*
-1 5 5|*
0 3 2|*
1 1 1|*
2 1 0|=
3 0 0|
> 4 16 -|==


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 224.8094
P(chi-square) = 4.515e-311

Total sequences searched: 3085

Whole sequence top hits:
tophits_s report:
Total hits: 14
Satisfying E cutoff: 14
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 14
Satisfying E cutoff: 14
Total memory: 26K


Acknowledgements:

This research is funded by:

Developed by: