Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

2 accessions found for Pseudomonas fluorescens SBW25  

Data for AM181176  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AM181176.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM181176_2867 CDS_3207949-3206798 70.0 3.6e-20 1
AM181176_4311 CDS_4869663-4870652 67.5 1.9e-19 1
AM181176_5452 CDS_6100974-6098980 63.8 2.5e-18 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM181176_2867 1/1 178 245 .. 1 70 [] 70.0 3.6e-20
AM181176_4311 1/1 119 183 .. 1 70 [] 67.5 1.9e-19
AM181176_5452 1/1 467 534 .. 1 70 [] 63.8 2.5e-18

Alignments of top-scoring domains:
AM181176_2867: domain 1 of 1, from 178 to 245: score 70.0, E = 3.6e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R A +LHD+++Q+L+++ l++ + + ++ p+ + + l++i
AM181176_2 178 ERKRVAYDLHDGLAQTLAGLHQRLQGFAGRC--PTLPGTLNADLQAI 222

relarealaevRrllgdLRpaal<-*
+la+++ e R+l+ +LRp++l
AM181176_2 223 LTLAQHSVGEGRQLIAGLRPTVL 245

AM181176_4311: domain 1 of 1, from 119 to 183: score 67.5, E = 1.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++RELHD +gQ L+a+klq+e+++ ++ p+ ++ + + +
AM181176_4 119 ERHRLSRELHDDIGQLLTAAKLQSEWLK-----RRLPDDLQSQCTVL 160

relarealaevRrllgdLRpaal<-*
+++e+la vR++ L p +l
AM181176_4 161 CNTLNETLAKVRDVSAILNPRQL 183

AM181176_5452: domain 1 of 1, from 467 to 534: score 63.8, E = 2.5e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aRIARE HD++gQ+L+++kl +++++ ++ + ++ + e+l +
AM181176_5 467 EKARIAREVHDELGQMLTVLKLETSMCELAY--AQLDPGLHERLNSM 511

relarealaevRrllgdLRpaal<-*
++l+ + + vR+++++LRp++l
AM181176_5 512 KRLIAQLFQLVRDVATALRPPIL 534


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-14 16 0|=
-13 64 0|====
-12 124 66|===*===
-11 259 542|=============== *
-10 773 1259|=========================================== *
-9 1054 1429|==========================================================*
-8 917 1102|=================================================== *
-7 805 692|======================================*======
-6 632 392|=====================*==============
-5 495 210|===========*================
-4 302 109|======*==========
-3 172 56|===*======
-2 117 28|=*=====
-1 68 14|*===
0 39 7|*==
1 34 3|*=
2 15 1|*
3 11 0|=
4 3 0|=
5 4 0|=
6 6 0|=
7 2 0|=
8 1 0|=
9 2 0|=
10 1 0|=
> 11 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2235.6545
P(chi-square) = 0

Total sequences searched: 6009

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: