Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Rhizobium leguminosarum bv. viciae 3841  

Data for AM236080  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: AM236080.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM236080_2896 CDS_3057281-3056217 98.5 9.3e-28 1
AM236080_1173 CDS_1239463-1238348 96.4 3.5e-27 1
AM236080_0452 CDS_487407-486328 82.7 2.8e-23 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM236080_2896 1/1 159 243 .. 1 94 [] 98.5 9.3e-28
AM236080_1173 1/1 148 231 .. 1 94 [] 96.4 3.5e-27
AM236080_0452 1/1 163 251 .. 1 94 [] 82.7 2.8e-23

Alignments of top-scoring domains:
AM236080_2896: domain 1 of 1, from 159 to 243: score 98.5, E = 9.3e-28
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HR+ N+L ++ +L+r+Q+ ++d+ + ++aL+E+q R+ +
AM236080_2 159 EVNHRIANSLGLVGALIRMQSSMTTDQVA-----IDALHETQMRINA 200

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H++LY+++ +++v ++eYl+ L+ +L s+++++ ++ +
AM236080_2 201 IASVHRRLYTNRQVGSVQVDEYLNSLLTELETSMRDDKRPHR----I 243

AM236080_1173: domain 1 of 1, from 148 to 231: score 96.4, E = 3.5e-27
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+LQ+I+S L+ ar++++ee+ + +L+ +++RV+S
AM236080_1 148 EVQHRVANSLQIIASVLMQSARRVQSEEA-----RGHLHNAHHRVMS 189

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A ++++L++s + ++v+++ Y++ L+ +L s+ + +++s +
AM236080_1 190 IAALQRQLSMSNG-GKVELRTYFTQLCQSLGASMIADPERLS----I 231

AM236080_0452: domain 1 of 1, from 163 to 251: score 82.7, E = 2.8e-23
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRVKNNLQ+I++L+r++ar+++ e e + +R+ +
AM236080_0 163 ELQHRVKNNLQMITALIRMEARNAQQNEE-----SERFARLAGRIEA 204

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
Al+++ L+ e tvd++ Y++ ++++ + +++v++++++ k+D+
AM236080_0 205 LALLYRSLSDEEKGATVDLGTYVSQIAASVMAAHAVEGIRLDMKVDT 251


Histogram of all scores:
score obs exp (one = represents 22 sequences)
----- --- ---
-15 5 0|=
-14 12 0|=
-13 58 29|=*=
-12 232 308|=========== *
-11 1278 859|=======================================*===================
-10 1103 1112|==================================================*
-9 784 939|==================================== *
-8 519 630|======================== *
-7 284 374|============= *
-6 226 208|=========*=
-5 98 112|=====*
-4 46 59|==*
-3 23 31|=*
-2 11 16|*
-1 7 8|*
0 5 4|*
1 3 2|*
2 2 1|*
3 0 0|
4 0 0|
> 5 4 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 328.2189
P(chi-square) = 0

Total sequences searched: 4737

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: