Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Rhizobium leguminosarum bv. viciae 3841  

Data for AM236080  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AM236080.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM236080_3708 CDS_3900786-3901772 139.8 2.1e-47 1
AM236080_3716 CDS_3909182-3911749 125.6 1.4e-42 1
AM236080_4134 CDS_4377517-4379169 73.4 8.6e-25 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM236080_3708 1/1 131 213 .. 1 85 [] 139.8 2.1e-47
AM236080_3716 1/1 522 604 .. 1 85 [] 125.6 1.4e-42
AM236080_4134 1/1 357 438 .. 1 85 [] 73.4 8.6e-25

Alignments of top-scoring domains:
AM236080_3708: domain 1 of 1, from 131 to 213: score 139.8, E = 2.1e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+LA++Q+ia+QT+Rn+ sld+f+ +F+gRLq+Ls+++dL
AM236080_3 131 ELSHRSKNLLAIIQGIATQTARNTLSLDSFLLKFRGRLQSLSNSQDL 177

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+s+W+gA L+eL+e ++aPy++e a+ + G +
AM236080_3 178 --ITDSSWRGAYLFELAEKQFAPYWPETAGSMPIYGIN 213

AM236080_3716: domain 1 of 1, from 522 to 604: score 125.6, E = 1.4e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRV+N+L+++ +++rQ+ ++ sl ++ ++++gR+q+L+raHd+
AM236080_3 522 ELNHRVRNILSLITGVIRQSQATSVSLGDYIRQLEGRIQSLARAHDQ 568

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+tr++Wa+A+Lr+Ll ae a+y g+ a+Ri++ G+d
AM236080_3 569 --ITRDHWAPASLRQLLLAETAAYFGKNAQRIQMGGED 604

AM236080_4134: domain 1 of 1, from 357 to 438: score 73.4, E = 8.6e-25
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR KN+L++ Q+++rQ +++++s++ f++a+++RL L r+ L
AM236080_4 357 ELVHRTKNLLTLAQAMMRQLAKQSDSVETFRAAVADRLEGLVRSIEL 403

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++W+g++Lr ++ + L ++ + +e+i +sG+d
AM236080_4 404 --LTSEQWGGVSLRRVVDIHLHAFPQS-REQIDISGED 438


Histogram of all scores:
score obs exp (one = represents 16 sequences)
----- --- ---
-14 5 0|=
-13 40 0|===
-12 377 0|========================
-11 516 38|==*==============================
-10 700 486|==============================*=============
-9 872 1202|======================================================= *
-8 890 1248|======================================================== *
-7 558 838|=================================== *
-6 300 457|=================== *
-5 199 226|============= *
-4 112 107|======*
-3 57 49|===*
-2 34 22|=*=
-1 18 10|*=
0 9 4|*
1 4 2|*
> 2 9 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 6390.5610
P(chi-square) = 0

Total sequences searched: 4737

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: