hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AM236084.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM236084_0408 CDS_426163-424778 73.2 3.3e-22 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM236084_0408 1/1 250 317 .. 1 70 [] 73.2 3.3e-22
Alignments of top-scoring domains:
AM236084_0408: domain 1 of 1, from 250 to 317: score 73.2, E = 3.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD+++Q+L +++ ++la r + +++ + a+ ++d+
AM236084_0 250 ERARLARELHDGISQNLVGVRYAMDLAGRKV--RTNVDDAALTIDRG 294
relarealaevRrllgdLRpaal<-*
e+++ a++e+Rrl +dLRp +l
AM236084_0 295 VEALNGAIKEIRRLSHDLRPRVL 317
Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-13 3 0|==
-12 12 4|=*====
-11 19 40|========== *
-10 63 93|================================ *
-9 72 106|==================================== *
-8 80 82|========================================*
-7 62 51|=========================*=====
-6 38 29|==============*====
-5 38 15|=======*===========
-4 20 8|===*======
-3 12 4|=*====
-2 8 2|*===
-1 9 1|*====
0 3 0|==
1 0 0|
> 2 3 -|==
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 86.3522
P(chi-square) = 6.929e-16
Total sequences searched: 471
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K