Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

7 accessions found for Rhizobium leguminosarum bv. viciae 3841  

Data for AM236085  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AM236085.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM236085_0328 CDS_355315-354290 104.5 3.1e-36 1
AM236085_0329 CDS_355520-356557 90.6 1.7e-31 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM236085_0328 1/1 144 226 .. 1 85 [] 104.5 3.1e-36
AM236085_0329 1/1 160 237 .. 1 85 [] 90.6 1.7e-31

Alignments of top-scoring domains:
AM236085_0328: domain 1 of 1, from 144 to 226: score 104.5, E = 3.1e-36
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KNt+AvVQ+i Q++Rna s++++ +++s+R+ A s aHd+
AM236085_0 144 ELSHRMKNTMAVVQAITSQSFRNASSMEDAEQSISARINAYSKAHDI 190

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W g +++ ++ea+ g e ++R++ sGP+
AM236085_0 191 --LLQQDWLGTTMATIVEATAINLGLETSGRFRASGPA 226

AM236085_0329: domain 1 of 1, from 160 to 237: score 90.6, E = 1.7e-31
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN LA+V Si+r + na++++ +++a+ R qAL+raH L
AM236085_0 160 EVDHRSKNVLAIVDSIVRLS--NADDPALYAAAIQHRVQALARAHTL 204

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + W +L eL+++++ P++ a+R + GPd
AM236085_0 205 --LAARGWTNISLEELIRQQVTPFA---ATRAIFNGPD 237


Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-14 2 0|=
-13 8 0|====
-12 44 0|======================
-11 60 5|==*===========================
-10 110 65|================================*======================
-9 107 162|====================================================== *
-8 110 168|======================================================= *
-7 86 113|=========================================== *
-6 43 61|====================== *
-5 29 30|==============*
-4 15 14|======*=
-3 10 6|==*==
-2 2 3|=*
-1 5 1|*==
> 0 3 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 663.1380
P(chi-square) = 0

Total sequences searched: 644

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: