Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

3 accessions found for Ralstonia eutropha H16  

Data for AM260479  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AM260479.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM260479_0775 CDS_850726-851793 71.4 8.5e-21 1
AM260479_1934 CDS_2160415-2158811 69.1 3.9e-20 1
AM260479_0155 CDS_170146-168743 64.6 8.7e-19 1
AM260479_3613 CDS_4002529-4003935 60.2 1.7e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM260479_0775 1/1 148 216 .. 1 70 [] 71.4 8.5e-21
AM260479_1934 1/1 331 400 .. 1 70 [] 69.1 3.9e-20
AM260479_0155 1/1 249 316 .. 1 70 [] 64.6 8.7e-19
AM260479_3613 1/1 249 319 .. 1 70 [] 60.2 1.7e-17

Alignments of top-scoring domains:
AM260479_0775: domain 1 of 1, from 148 to 216: score 71.4, E = 8.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+RI+RELHD++gQsL+a++l+l+ ++++ d++++ r++l++
AM260479_0 148 ERTRISRELHDELGQSLTALRLGLSFIEAQQ--GPDAGdACRKHLQM 192

irelarealaevRrllgdLRpaal<-*
++++a+ + + v r++ dLRp+ l
AM260479_0 193 LKQIADSTVDAVQRIAADLRPPLL 216

AM260479_1934: domain 1 of 1, from 331 to 400: score 69.1, E = 3.9e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RIARELHD +gQ+Lsa+k+ + ++ + + d+ ++ + +++
AM260479_1 331 ERRRIARELHDDLGQRLSALKMDMAMLGADV--DEGRDtaGLLDEIG 375

eirelarealaevRrllgdLRpaal<-*
+i + ++ + a vRr+++dLRpa l
AM260479_1 376 AINGVIDNTVASVRRIASDLRPALL 400

AM260479_0155: domain 1 of 1, from 249 to 316: score 64.6, E = 8.7e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +R+ARELHD++g L+aikl l+++rr + ++d + a+e+l+++
AM260479_0 249 EKTRLARELHDELGAILTAIKLDLHWVRRKV--QEDHPVAAERLTRV 293

relarealaevRrllgdLRpaal<-*
+ +++++++ Rrl+ dLRp++l
AM260479_0 294 MLHVDQGIQIKRRLIEDLRPTVL 316

AM260479_3613: domain 1 of 1, from 249 to 319: score 60.2, E = 1.7e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ERaR++RELHD+++Q L ++kl le+a +l + +p+++ +++ l
AM260479_3 249 ERARLSRELHDGISQLLVSVKLVLETATNRL--RLAPAegaAVAPVL 293

deirelarealaevRrllgdLRpaal<-*
++ +++ +evRr++++LRpa l
AM260479_3 294 GMALNRLDTVFNEVRRVARNLRPALL 319


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 4 0|=
-13 34 0|===
-12 72 40|===*==
-11 126 334|=========== *
-10 384 776|================================ *
-9 668 881|======================================================== *
-8 517 679|============================================ *
-7 501 427|===================================*======
-6 418 241|====================*==============
-5 392 129|==========*======================
-4 186 67|=====*==========
-3 122 34|==*========
-2 103 17|=*=======
-1 50 9|*====
0 24 4|*=
1 18 2|*=
2 8 1|*
3 3 0|=
4 5 0|=
5 3 0|=
6 2 0|=
> 7 11 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2132.8792
P(chi-square) = 0

Total sequences searched: 3651

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: