hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AM260480.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM260480_2309 CDS_2643643-2645667 65.8 2.6e-19 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM260480_2309 1/1 451 519 .. 1 70 [] 65.8 2.6e-19
Alignments of top-scoring domains:
AM260480_2309: domain 1 of 1, from 451 to 519: score 65.8, E = 2.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ A+ LHDs++Q+L ++lq++l+ ++++ ++d +e re + ++
AM260480_2 451 ERNLVAQGLHDSIAQGLNYLNLQVQLLDAAVE-RDDLAETREIVPML 496
relarealaevRrllgdLRpaal<-*
r+ ++e++++vR+ll ++R
AM260480_2 497 RHGVEESYQDVRELLNNFRSRLG 519
Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 1 0|=
-13 23 0|====
-12 29 28|===*=
-11 88 234|============= *
-10 261 543|====================================== *
-9 409 617|==========================================================*
-8 408 475|==========================================================*
-7 328 298|==========================================*====
-6 338 169|========================*========================
-5 286 90|============*============================
-4 133 47|======*============
-3 96 24|===*==========
-2 54 12|=*======
-1 36 6|*=====
0 17 3|*==
1 9 1|*=
2 14 0|==
3 8 0|==
4 7 0|=
5 3 0|=
> 6 7 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1551.7391
P(chi-square) = 0
Total sequences searched: 2555
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K