Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

2 accessions found for Yersinia enterocolitica subsp. enterocolitica 8081  

Data for AM286415  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AM286415.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM286415_2341 CDS_2661522-2663303 75.6 5.2e-22 1
AM286415_2515 CDS_2874121-2875698 61.8 6.3e-18 1
AM286415_3924 CDS_4472777-4471248 52.2 4.4e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM286415_2341 1/1 392 459 .. 1 70 [] 75.6 5.2e-22
AM286415_2515 1/1 314 379 .. 1 70 [] 61.8 6.3e-18
AM286415_3924 1/1 309 374 .. 1 70 [] 52.2 4.4e-15

Alignments of top-scoring domains:
AM286415_2341: domain 1 of 1, from 392 to 459: score 75.6, E = 5.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARELHDs++QsLs +k+q++ +++++ ++ p++ + ++++
AM286415_2 392 ERSAIARELHDSIAQSLSCLKIQISCLQMQV--PDLPDPSKLLIQQM 436

relarealaevRrllgdLRpaal<-*
r+ ++ a++++R+ll+++R
AM286415_2 437 RDELNIAYRQLRELLTTFRLKLN 459

AM286415_2515: domain 1 of 1, from 314 to 379: score 61.8, E = 6.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IARELHD++gQ+++ai +q+ l+ r + +++ +a+ a+ +i
AM286415_2 314 VRKEIARELHDEIGQNITAIQIQAMLVNRSA--PSP--AAQSAANQI 356

relarealaevRrllgdLRpaal<-*
l+++ + +R+ll++LRp++l
AM286415_2 357 SSLSQRIHQTTRQLLRQLRPPVL 379

AM286415_3924: domain 1 of 1, from 309 to 374: score 52.2, E = 4.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ ARELHD+vgQ+ ++i+ q++ ++rl + + + + + +i
AM286415_3 309 ARRNVARELHDEVGQTVTVIRTQASIIKRLS--TQE--TVLTSAGMI 351

relarealaevRrllgdLRpaal<-*
++la + ++ v ++l L paal
AM286415_3 352 ETLALRVYDGVHDVLAKLWPAAL 374


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-16 1 0|=
-15 0 0|
-14 17 0|==
-13 77 0|======
-12 165 44|===*========
-11 230 364|================= *
-10 674 846|================================================= *
-9 792 960|========================================================= *
-8 600 740|=========================================== *
-7 503 465|=================================*==
-6 332 263|==================*=====
-5 239 141|==========*=======
-4 138 73|=====*====
-3 84 37|==*===
-2 49 19|=*==
-1 35 9|*==
0 24 5|*=
1 8 2|*
2 2 1|*
3 3 0|=
4 1 0|=
5 1 0|=
> 6 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 849.2352
P(chi-square) = 0

Total sequences searched: 4048

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: