Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Saccharopolyspora erythraea NRRL 2338  

Data for AM420293  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AM420293.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM420293_7066 CDS_8068824-8067676 90.6 3.5e-26 1
AM420293_3011 CDS_3395305-3396603 84.6 2.1e-24 1
AM420293_0935 CDS_1075954-1074635 82.2 1.1e-23 1
AM420293_1668 CDS_1873891-1875144 80.0 4.9e-23 1
AM420293_1874 CDS_2094869-2096053 77.8 2.1e-22 1
AM420293_7053 CDS_8055640-8053859 69.2 7.2e-20 1
AM420293_6438 CDS_7425047-7423866 66.7 4e-19 1
AM420293_6514 CDS_7507205-7505961 63.0 4.9e-18 1
AM420293_1195 CDS_1346130-1347383 61.0 1.9e-17 1
AM420293_0774 CDS_881463-880141 60.7 2.4e-17 1
AM420293_1623 CDS_1827236-1826061 58.8 8.7e-17 1
AM420293_0143 CDS_174238-175386 58.3 1.2e-16 1
AM420293_3587 CDS_4025772-4027085 55.0 1.1e-15 1
AM420293_5115 CDS_5850536-5849436 55.0 1.1e-15 1
AM420293_2325 CDS_2583740-2585053 53.9 2.4e-15 1
AM420293_6868 CDS_7869967-7871508 44.0 2e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM420293_7066 1/1 179 247 .. 1 70 [] 90.6 3.5e-26
AM420293_3011 1/1 198 265 .. 1 70 [] 84.6 2.1e-24
AM420293_0935 1/1 216 283 .. 1 70 [] 82.2 1.1e-23
AM420293_1668 1/1 202 269 .. 1 70 [] 80.0 4.9e-23
AM420293_1874 1/1 179 246 .. 1 70 [] 77.8 2.1e-22
AM420293_7053 1/1 371 438 .. 1 70 [] 69.2 7.2e-20
AM420293_6438 1/1 188 253 .. 1 70 [] 66.7 4e-19
AM420293_6514 1/1 224 291 .. 1 70 [] 63.0 4.9e-18
AM420293_1195 1/1 205 270 .. 1 70 [] 61.0 1.9e-17
AM420293_0774 1/1 250 317 .. 1 70 [] 60.7 2.4e-17
AM420293_1623 1/1 173 240 .. 1 70 [] 58.8 8.7e-17
AM420293_0143 1/1 183 251 .. 1 70 [] 58.3 1.2e-16
AM420293_3587 1/1 199 261 .. 1 64 [. 55.0 1.1e-15
AM420293_5115 1/1 170 228 .. 1 63 [. 55.0 1.1e-15
AM420293_2325 1/1 218 288 .. 1 70 [] 53.9 2.4e-15
AM420293_6868 1/1 185 253 .. 1 70 [] 44.0 2e-12

Alignments of top-scoring domains:
AM420293_7066: domain 1 of 1, from 179 to 247: score 90.6, E = 3.5e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD++++s s+++ q+++a +l + pe+a++al++i
AM420293_7 179 ERNRIARELHDVLAHSVSVMITQADGATFAL--HGKPEMAEKALRAI 223

relarealaevRrllgdLR.paal<-*
e++r+al+e+R ll +LR+p++
AM420293_7 224 GETGRDALSELRGLLEVLRnPDEG 247

AM420293_3011: domain 1 of 1, from 198 to 265: score 84.6, E = 2.1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE HD+v+++Ls+++l +++ar+++ ++dp+ ar +l+e+
AM420293_3 198 ERARIAREFHDVVSHNLSVVALRAGVARAVM--ERDPDHARGTLREL 242

relarealaevRrllgdLRpaal<-*
+e++r al+e+R++l+++R++a
AM420293_3 243 EETSRSALDEMRNVLTAFREGAV 265

AM420293_0935: domain 1 of 1, from 216 to 283: score 82.2, E = 1.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA ELHDsvg++L +++lq+++a r+l d+dpe ar+al++i
AM420293_0 216 ERNRIASELHDSVGHTLNVVTLQASAAGRVL--DTDPEFARQALRAI 260

relarealaevRrllgdLRpaal<-*
+e r+al+++ ++lg+LR a
AM420293_0 261 EESTRRALEDLDHALGVLRAEAP 283

AM420293_1668: domain 1 of 1, from 202 to 269: score 80.0, E = 4.9e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RIARELHD++++s+s i++q+++ar+++ + ++e+ +++ +
AM420293_1 202 EKTRIARELHDVIAHSMSIINVQASTARYRY--PGMDGELVGEFESM 246

relarealaevRrllgdLRpaal<-*
++ +r+al+e+R llg+LR+ +
AM420293_1 247 AASSRQALTEMRGLLGVLRDEEA 269

AM420293_1874: domain 1 of 1, from 179 to 246: score 77.8, E = 2.1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE HD v+++Ls+++l +++ar+l+ d+dp+ are+l+ +
AM420293_1 179 ERARIAREFHDIVSHNLSVVALRAGVARALV--DRDPGHARETLRDL 223

relarealaevRrllgdLRpaal<-*
+ +++ al+e+R +lg+LR ++
AM420293_1 224 EVTSSAALSEMRTMLGALRADTS 246

AM420293_7053: domain 1 of 1, from 371 to 438: score 69.2, E = 7.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD+v+++ ++i +q+++a+ + +k+p +a eal++i
AM420293_7 371 ERMALARELHDVVAHHVTGIVVQAQAAQLVS--EKNPRAATEALARI 415

relarealaevRrllgdLRpaal<-*
++ + eal+ +Rrl+ +R a+
AM420293_7 416 ADSGTEALTAMRRLVASMRGAEP 438

AM420293_6438: domain 1 of 1, from 188 to 253: score 66.7, E = 4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v+++ s+i+lq++++ l ++++e+ e ++ i
AM420293_6 188 ERRRIAREMHDVVAHRCSVISLQAGAL--TL--TAPDERTGEVAEVI 230

relarealaevRrllgdLRpaal<-*
r+++ +al+e+R +l++LR+++
AM420293_6 231 RKTSATALTELRSMLRVLREDEN 253

AM420293_6514: domain 1 of 1, from 224 to 291: score 63.0, E = 4.9e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+++ l++a++++ ++dpe ++ l+e+
AM420293_6 224 ELRRIERDLHDGAQAQLVALAMRLGVAEKAV--RDDPETTARLLREA 268

relarealaevRrllgdLRpaal<-*
r+ a+ea++ +R++++++ p++l
AM420293_6 269 RDGAEEAMTGLRDVVRTIYPPIL 291

AM420293_1195: domain 1 of 1, from 205 to 270: score 61.0, E = 1.9e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+A E+HD+v ++ s++ lq++++ + +++ + rea++++
AM420293_1 205 ERARLAAEMHDVVTHRVSLMVLQAGALGVTA--KDE--QTREAAEQL 247

relarealaevRrllgdLRpaal<-*
r+ + ealae+R+l+g+LR a +
AM420293_1 248 RASGCEALAELRDLVGVLRRAPE 270

AM420293_0774: domain 1 of 1, from 250 to 317: score 60.7, E = 2.4e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A +LHD+ g++L ai+l+ ela+rl+ d+++ar++++e+
AM420293_0 250 ERLRFAADLHDVQGHHLQAIALKGELAERLV--GVDDDAARAQAAEV 294

relarealaevRrllgdLRpaal<-*
+elar+al+++R++++++R + l
AM420293_0 295 AELARTALRDTREVVHGYRRTSL 317

AM420293_1623: domain 1 of 1, from 173 to 240: score 58.8, E = 8.7e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE+HD+v+++ ++ + +++++ + d++p+e ++ ++++
AM420293_1 173 ERSRIAREMHDVVAHQVGLAVIYSGALEVST--DTEPAETARLARQV 217

relarealaevRrllgdLRpaal<-*
++ r+al+e+R+++g+LR a+
AM420293_1 218 GDANRQALRELREVIGVLRLAGG 240

AM420293_0143: domain 1 of 1, from 183 to 251: score 58.3, E = 1.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD++ Q+L a+ +qle+++r+ld + + + +++l+e
AM420293_0 183 ERERIARDLHDVIVQRLYAAGVQLEVLERRLD-GRLDTPDARRLAET 228

relarealaevRrllgdLRpaal<-*
++ +++++aevR+++++L a+
AM420293_0 229 MDQIDQTIAEVRATVRTLTSADP 251

AM420293_3587: domain 1 of 1, from 199 to 261: score 55.0, E = 1.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI+R+LHD+ g +L+ i+++++la l++ ++++e+a+++++++
AM420293_3 199 ERLRISRDLHDVFGRTLATIAVKSSLASELVR-RRHDERAAAEITAV 244

relarealaevRrllgd<-*
r+la+ea +evR+++++
AM420293_3 245 RQLAEEAGTEVRHIVRG 261

AM420293_5115: domain 1 of 1, from 170 to 228: score 55.0, E = 1.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD vg++ ++i++ + ++++ +++ + +e + ++
AM420293_5 170 ERTRIAREIHDAVGHQVTLIAVESAALAATS--EEP--ATQESAGRL 212

relarealaevRrllg<-*
r+la++al+e+R +lg
AM420293_5 213 RALAKQALDEMRTTLG 228

AM420293_2325: domain 1 of 1, from 218 to 288: score 53.9, E = 2.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ER+RIARELHDsv Q+ ++ + +e++r+ l ++ + +++++e+l
AM420293_2 218 ERHRIARELHDSVTQAVLSAGMIVEVCRAEL--AALGGaseQVAERL 262

deirelarealaevRrllgdLRpaal<-*
+ ++el ++a a++R ++ +L+ +a+
AM420293_2 263 QPAKELTQQAVAQLRSAIYALHRGAE 288

AM420293_6868: domain 1 of 1, from 185 to 253: score 44.0, E = 2e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA ++HD +g+ Ls+++l +++++ ++ ++ + + re + e+
AM420293_6 185 ERTRIAGDMHDLLGHELSLVALRIGGLE-VA--PDLDSRHREVAGEA 228

relarealaevRrllgdLR..paal<-*
r+++ a + +R+++ LR++p+ l
AM420293_6 229 RAAVTSAAQRLREVVEMLReePPPL 253


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-14 18 0|=
-13 75 1|*====
-12 128 80|====*===
-11 189 659|=========== *
-10 579 1530|================================= *
-9 1058 1738|==========================================================*
-8 1011 1339|========================================================= *
-7 1035 842|==============================================*===========
-6 829 476|==========================*====================
-5 886 255|==============*===================================
-4 500 133|=======*====================
-3 336 68|===*===============
-2 194 35|=*=========
-1 156 17|*========
0 64 9|*===
1 47 4|*==
2 25 2|*=
3 15 1|*
4 16 0|=
5 2 0|=
6 3 0|=
7 3 0|=
8 2 0|=
9 1 0|=
10 1 0|=
11 0 0|
12 1 0|=
13 1 0|=
14 1 0|=
> 15 21 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 7330.9409
P(chi-square) = 0

Total sequences searched: 7198

Whole sequence top hits:
tophits_s report:
Total hits: 16
Satisfying E cutoff: 16
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 16
Satisfying E cutoff: 16
Total memory: 26K


Acknowledgements:

This research is funded by:

Developed by: