Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

3 accessions found for Clavibacter michiganensis subsp. michiganensis NCPPB 382  

Data for AM711867  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AM711867.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM711867_1591 CDS_1776773-1778284 84.3 1.1e-24 1
AM711867_0660 CDS_732228-731008 82.8 2.9e-24 1
AM711867_0723 CDS_795421-796800 82.0 5.2e-24 1
AM711867_0417 CDS_484506-483097 78.6 5.1e-23 1
AM711867_1290 CDS_1446223-1444979 75.4 4.6e-22 1
AM711867_2768 CDS_3070638-3071813 69.0 3.4e-20 1
AM711867_0103 CDS_135962-134808 59.7 2e-17 1
AM711867_0024 CDS_28837-29955 57.1 1.1e-16 1
AM711867_1986 CDS_2220741-2219605 56.0 2.5e-16 1
AM711867_1259 CDS_1410843-1412144 53.4 1.4e-15 1
AM711867_0180 CDS_229937-231484 53.4 1.4e-15 1
AM711867_2085 CDS_2328724-2329971 37.0 9.4e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM711867_1591 1/1 207 274 .. 1 70 [] 84.3 1.1e-24
AM711867_0660 1/1 198 266 .. 1 70 [] 82.8 2.9e-24
AM711867_0723 1/1 242 309 .. 1 70 [] 82.0 5.2e-24
AM711867_0417 1/1 226 293 .. 1 70 [] 78.6 5.1e-23
AM711867_1290 1/1 181 249 .. 1 70 [] 75.4 4.6e-22
AM711867_2768 1/1 192 257 .. 1 70 [] 69.0 3.4e-20
AM711867_0103 1/1 180 247 .. 1 70 [] 59.7 2e-17
AM711867_0024 1/1 178 243 .. 1 70 [] 57.1 1.1e-16
AM711867_1986 1/1 178 235 .. 1 62 [. 56.0 2.5e-16
AM711867_1259 1/1 208 276 .. 1 70 [] 53.4 1.4e-15
AM711867_0180 1/1 281 348 .. 1 70 [] 53.4 1.4e-15
AM711867_2085 1/1 202 260 .. 2 64 .. 37.0 9.4e-11

Alignments of top-scoring domains:
AM711867_1591: domain 1 of 1, from 207 to 274: score 84.3, E = 1.1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR++HD+v++sL++++ q+++ar++ dpe+a+eal++i
AM711867_1 207 ERNRIARDMHDVVAHSLAVVIAQADGARYAR--LVDPEAADEALRTI 251

relarealaevRrllgdLRpaal<-*
++ar+al +vR ll +LR++++
AM711867_1 252 STTARQALGDVRILLAQLRHSED 274

AM711867_0660: domain 1 of 1, from 198 to 266: score 82.8, E = 2.9e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+++++Ls+++l++++++++ d d++e+r+++ +
AM711867_0 198 ERTRIAREMHDVLAHRLSLVALHAGALEYRD--DLDAAEVRATAGVV 242

relarealaevRrllgdLR.paal<-*
r+ ar+al+e+R +lg+LR+p++
AM711867_0 243 RDNARTALTELRGVLGVLRdPSGA 266

AM711867_0723: domain 1 of 1, from 242 to 309: score 82.0, E = 5.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD+ +++L+a+ +q+++a+rl+ d dpe+a++ l+ i
AM711867_0 242 ERTRMARELHDVAAHHLTALVVQAGAAERLV--DLDPERAKDSLRGI 286

relarealaevRrllgdLRpaal<-*
r+ +re+l+ +R ++g LR + +
AM711867_0 287 RRQGRETLDALRSIVGILRQGSD 309

AM711867_0417: domain 1 of 1, from 226 to 293: score 78.6, E = 5.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++ s++ +++++arr+l ++d+++a++ l +
AM711867_0 226 ERVRIARELHDVVAHHVSVMGVHAGAARRVL--ARDADKAAASLGIV 270

relarealaevRrllgdLRpaal<-*
++ ar a++e+ r+l +LR +++
AM711867_0 271 EDNARSAIEELHRMLVALRQDED 293

AM711867_1290: domain 1 of 1, from 181 to 249: score 75.4, E = 4.6e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD v+++++++ +++a++ + + pe ar+a++e+
AM711867_1 181 ERTRIAREIHDIVAHGITVMVTLADGAAASA--VARPELARDAMREV 225

relarealaevRrllgdLR.paal<-*
+e++r++l+e+Rr+lg+L ++++
AM711867_1 226 AETGRTSLSEMRRMLGVLAeEPGA 249

AM711867_2768: domain 1 of 1, from 192 to 257: score 69.0, E = 3.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HD+v+Q+Ls+i + l++a++ ++ + + ++++ +
AM711867_2 192 ERARLAREIHDTVAQGLSSIQMLLHAAEA----ADGDRPGLDHIRLA 234

relarealaevRrllgdLRpaal<-*
r++a ++la++Rr +++L p+ l
AM711867_2 235 RATAADGLADTRRFIRELAPPSL 257

AM711867_0103: domain 1 of 1, from 180 to 247: score 59.7, E = 2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHDsv+ sL++i+l++ a+r++ ++dp++ar+al+++
AM711867_0 180 ERVRIARDLHDSVANSLAVIALHSTDAERHV--EDDPARARRALRTV 224

relarealaevRrllgdLRpaal<-*
r+ + +l+e+ ++l +LR+a
AM711867_0 225 RTVSAGTLQELAAILAVLRDARS 247

AM711867_0024: domain 1 of 1, from 178 to 243: score 57.1, E = 1.1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa +ARE+HD+v+++ s+i++q+++++ + +++ + rea+++i
AM711867_0 178 ERAVLAREMHDVVSHQVSLIAVQAGALQVGA--ADE--RSREAARTI 220

relarealaevRrllgdLRpaal<-*
r+l+ +l+e+R ++ +LR a+
AM711867_0 221 RGLSTVTLEELRGMVEVLRAAGG 243

AM711867_1986: domain 1 of 1, from 178 to 235: score 56.0, E = 2.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+ ++HD+++++L+++++q+e r+ + +++ ea + +++i
AM711867_1 178 ERERISDDMHDVLAHTLTSVIVQAESGRATA--PSP--EASRMFRTI 220

relarealaevRrll<-*
e++r al evR ll
AM711867_1 221 SETSRAALHEVRGLL 235

AM711867_1259: domain 1 of 1, from 208 to 276: score 53.4, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++ ++HD+v+Q L+++ + +++ rr l+ d+++ ++l+e+
AM711867_1 208 ERERLSADIHDTVAQDLTGLVMLAQRGRRELR-GGDADATGATLAEL 253

relarealaevRrllgdLRpaal<-*
+e ar+al+++R+++ + p++l
AM711867_1 254 EEGARDALTQTRAIVAATAPMEL 276

AM711867_0180: domain 1 of 1, from 281 to 348: score 53.4, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+ I R+LHD+ Q+L +++ l +a+r+l d+dpe+ar+ ++e+
AM711867_0 281 TLRQIERDLHDGPQQRLVRLRMDLAAAERAL--DTDPERARTLIAEA 325

relarealaevRrllgdLRpaal<-*
e+a+++l+e+R+l +++ p++l
AM711867_0 326 SEHAHDTLEELRALSRGFAPPIL 348

AM711867_2085: domain 1 of 1, from 202 to 260: score 37.0, E = 9.4e-11
*->RaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeir
Ra +AR+ HD vg+sL++i+ q++ ++ l d++ ++r ++i+
AM711867_2 202 RASMARDVHDIVGHSLAVIIAQADSVQFLD--DEE--RIRGVSATIA 244

elarealaevRrllgd<-*
++ar++laevR++l++
AM711867_2 245 DTARRSLAEVREVLSG 260


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 3 0|=
-13 23 0|===
-12 42 33|====*=
-11 83 273|=========== *
-10 278 634|=================================== *
-9 424 720|===================================================== *
-8 430 555|====================================================== *
-7 463 349|===========================================*==============
-6 372 197|========================*======================
-5 337 105|=============*=============================
-4 197 55|======*==================
-3 123 28|===*============
-2 86 14|=*=========
-1 38 7|*====
0 20 3|*==
1 17 1|*==
2 11 0|==
3 9 0|==
4 8 0|=
5 1 0|=
6 3 0|=
7 1 0|=
> 8 15 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2334.6853
P(chi-square) = 0

Total sequences searched: 3008

Whole sequence top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: