hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AM743169.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM743169_2564 CDS_2734614-2733067 72.0 2.4e-24 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM743169_2564 1/1 307 388 .. 1 85 [] 72.0 2.4e-24
Alignments of top-scoring domains:
AM743169_2564: domain 1 of 1, from 307 to 388: score 72.0, E = 2.4e-24
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+N+++++++ia T+ + s+de++e++ gRL++L+r+++L
AM743169_2 307 ELQHRVRNIMSTIHAIAWRTRESVSSVDEYAERLCGRLMSLARTQSL 353
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr ag+ Lr l +e+a+ +++a +l+G+d
AM743169_2 354 --LTRGANAGVCLRGMLDEEIAAQ-TPAAAAYRLQGED 388
Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 5 0|=
-13 43 0|====
-12 323 0|=========================
-11 422 35|==*==============================
-10 667 453|==================================*=================
-9 761 1122|==========================================================*
-8 741 1165|========================================================= *
-7 537 782|========================================== *
-6 344 427|=========================== *
-5 211 211|================*
-4 158 100|=======*=====
-3 67 46|===*==
-2 49 21|=*==
-1 24 9|*=
0 14 4|*=
1 10 2|*
2 4 0|=
3 1 0|=
4 1 0|=
> 5 4 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4723.1250
P(chi-square) = 0
Total sequences searched: 4430
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K
