Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

4 accessions found for Burkholderia cenocepacia J2315  

Data for AM747721  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AM747721.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM747721_1496 CDS_1660128-1658026 68.6 4.4e-20 1
AM747721_2833 CDS_3196014-3197396 66.4 2e-19 1
AM747721_0295 CDS_342084-340087 64.0 1e-18 1
AM747721_0628 CDS_692444-690639 53.4 1.4e-15 1
AM747721_1534 CDS_1701767-1700310 38.9 2.6e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM747721_1496 1/1 487 559 .. 1 70 [] 68.6 4.4e-20
AM747721_2833 1/1 253 323 .. 1 70 [] 66.4 2e-19
AM747721_0295 1/1 453 523 .. 1 70 [] 64.0 1e-18
AM747721_0628 1/1 385 452 .. 1 70 [] 53.4 1.4e-15
AM747721_1534 1/1 274 341 .. 1 70 [] 38.9 2.6e-11

Alignments of top-scoring domains:
AM747721_1496: domain 1 of 1, from 487 to 559: score 68.6, E = 4.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrllds...dkdpeeareal
E +RIARELHD +gQ+L+a+k+ l++++++l+ ++++ ++e ++++l
AM747721_1 487 EKTRIARELHDDLGQQLTALKMDLSVVEQQLRMpgrAQPDEGVQTHL 533

deirelarealaevRrllgdLRpaal<-*
+ +r+l++ + a vRr++ dLRp l
AM747721_1 534 QGMRRLIDATVASVRRIAADLRPVML 559

AM747721_2833: domain 1 of 1, from 253 to 323: score 66.4, E = 2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ERaR++RELHD+++Q++ ++kl+le a++++ ++ + +ea++al
AM747721_2 253 ERARLSRELHDGISQMMVSAKLMLESALARF--ERGTSrvpEAEQAL 297

deirelarealaevRrllgdLRpaal<-*
+ + + ++l+evRr+ ++LRp+ l
AM747721_2 298 ASGVGRLGDTLREVRRISHALRPSML 323

AM747721_0295: domain 1 of 1, from 453 to 523: score 64.0, E = 1e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
E +RIARELHD +gQ+L+a+k+ l++++ l + ++++ +re+l
AM747721_0 453 EKTRIARELHDDLGQQLTALKMDLSAVELGL--AGVVAphtGVREQL 497

deirelarealaevRrllgdLRpaal<-*
++++l++ + a vRr++ dLRp l
AM747721_0 498 GAMHRLIDSTVASVRRIAADLRPVML 523

AM747721_0628: domain 1 of 1, from 385 to 452: score 53.4, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RIARELHD+++Q+L+ +k le++ ++ + d++ +++ ++++
AM747721_0 385 EQRRIARELHDELAQTLATLKNDLEWLIDRV--PQDDASLARKIAAM 429

relarealaevRrllgdLRpaal<-*
++lar a a +Rr+++dLRp l
AM747721_0 430 HALARGAVAATRRIASDLRPLML 452

AM747721_1534: domain 1 of 1, from 274 to 341: score 38.9, E = 2.6e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD+ Q+ +++ l+l +++ + +++p + ++ ++
AM747721_1 274 ERTRIARDLHDTAKQRSFVLGLKLTELEYEA--QRHP-DLLPTVGAA 317

relarealaevRrllgdLR.paal<-*
r+la++ ++++ ++++++ pa+
AM747721_1 318 RRLADHLQQDLDNVVTGFSlPAIA 341


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 1 0|=
-13 19 0|===
-12 55 31|===*===
-11 94 257|=========== *
-10 294 596|================================= *
-9 496 677|======================================================== *
-8 430 522|================================================ *
-7 425 328|====================================*===========
-6 309 185|====================*==============
-5 275 99|==========*====================
-4 151 52|=====*===========
-3 84 26|==*=======
-2 63 13|=*=====
-1 37 6|*====
0 24 3|*==
1 15 1|*=
2 13 0|==
3 5 0|=
4 3 0|=
5 1 0|=
6 4 0|=
7 1 0|=
8 0 0|
9 1 0|=
10 0 0|
11 1 0|=
> 12 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1376.3301
P(chi-square) = 0

Total sequences searched: 2849

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: