Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

3 accessions found for Clavibacter michiganensis subsp. sepedonicus  

Data for AM849034  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AM849034.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM849034_1707 CDS_1827216-1825714 84.3 1.1e-24 1
AM849034_0496 CDS_533775-532630 82.8 3e-24 1
AM849034_2245 CDS_2422924-2421488 80.7 1.3e-23 1
AM849034_0946 CDS_1000817-999381 76.6 2.1e-22 1
AM849034_2093 CDS_2251127-2252368 75.4 4.6e-22 1
AM849034_0468 CDS_509398-508220 69.0 3.5e-20 1
AM849034_0027 CDS_30897-32057 56.5 1.7e-16 1
AM849034_0333 CDS_369396-370919 53.4 1.4e-15 1
AM849034_0981 CDS_1031063-1032391 51.4 5.5e-15 1
AM849034_1157 CDS_1222727-1221561 37.0 9.5e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM849034_1707 1/1 207 274 .. 1 70 [] 84.3 1.1e-24
AM849034_0496 1/1 173 241 .. 1 70 [] 82.8 3e-24
AM849034_2245 1/1 246 313 .. 1 70 [] 80.7 1.3e-23
AM849034_0946 1/1 238 305 .. 1 70 [] 76.6 2.1e-22
AM849034_2093 1/1 181 249 .. 1 70 [] 75.4 4.6e-22
AM849034_0468 1/1 192 257 .. 1 70 [] 69.0 3.5e-20
AM849034_0027 1/1 192 257 .. 1 70 [] 56.5 1.7e-16
AM849034_0333 1/1 282 349 .. 1 70 [] 53.4 1.4e-15
AM849034_0981 1/1 208 276 .. 1 70 [] 51.4 5.5e-15
AM849034_1157 1/1 176 234 .. 2 64 .. 37.0 9.5e-11

Alignments of top-scoring domains:
AM849034_1707: domain 1 of 1, from 207 to 274: score 84.3, E = 1.1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR++HD+v++sL++++ q+++ar++ dpe+a+eal++i
AM849034_1 207 ERNRIARDMHDVVAHSLAVVIAQADGARYAR--LVDPEAADEALRTI 251

relarealaevRrllgdLRpaal<-*
++ar+al +vR ll +LR++++
AM849034_1 252 STTARQALGDVRILLAQLRHSED 274

AM849034_0496: domain 1 of 1, from 173 to 241: score 82.8, E = 3e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+++++Ls+++l++++++++ d d++e+r+++ +
AM849034_0 173 ERTRIAREMHDVLAHRLSLVALHAGALEYRD--DLDAAEVRATAGVV 217

relarealaevRrllgdLR.paal<-*
r+ ar+al+e+R +lg+LR+p++
AM849034_0 218 RDNARTALTELRGVLGVLRdPSGA 241

AM849034_2245: domain 1 of 1, from 246 to 313: score 80.7, E = 1.3e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD+ +++L+a+ +q+++a+rl+ d dpe+are l+ i
AM849034_2 246 ERTRMARELHDVAAHHLTALVVQAGAAERLV--DLDPERARESLRGI 290

relarealaevRrllgdLRpaal<-*
r +re+l+ +R ++g LR + +
AM849034_2 291 RVQGRETLDALRSIVGILRQTSD 313

AM849034_0946: domain 1 of 1, from 238 to 305: score 76.6, E = 2.1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++ s++ +++++arr+l d+d ++a++ l +
AM849034_0 238 ERVRIARELHDVVAHHVSVMGVHAGAARRVL--DRDTAKAAASLGIV 282

relarealaevRrllgdLRpaal<-*
++ ar a++e+ r+l +LR ++
AM849034_0 283 EDNARSAIEELHRMLVALRQHDD 305

AM849034_2093: domain 1 of 1, from 181 to 249: score 75.4, E = 4.6e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD v+++++++ +++a++ + + pe ar+a++e+
AM849034_2 181 ERTRIAREIHDIVAHGITVMVTLADGAAASA--VARPELARDAMREV 225

relarealaevRrllgdLR.paal<-*
+e++r++l+e+Rr+lg+L ++++
AM849034_2 226 AETGRTSLSEMRRMLGVLAeEPGA 249

AM849034_0468: domain 1 of 1, from 192 to 257: score 69.0, E = 3.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HD+v+Q+Ls+i + l++a++ ++ + + ++++ +
AM849034_0 192 ERARLAREIHDTVAQGLSSIQMLLHAAEA----ADGDRPGLDHIRLA 234

relarealaevRrllgdLRpaal<-*
r++a ++la++Rr +++L p+ l
AM849034_0 235 RATAADGLADTRRFIRELAPPSL 257

AM849034_0027: domain 1 of 1, from 192 to 257: score 56.5, E = 1.7e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa +ARE+HD+v+++ s+i++q+++ + + +++ + rea+++i
AM849034_0 192 ERAVLAREMHDVVSHQVSLIAVQAGAMQVGA--ADE--PSREAARTI 234

relarealaevRrllgdLRpaal<-*
r+l+ +l+e+R ++ +LR a+
AM849034_0 235 RALSTVTLEELRGMVEVLRAAGG 257

AM849034_0333: domain 1 of 1, from 282 to 349: score 53.4, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+ I R+LHD+ Q+L +++ l +a+r+l d+dpe+ar+ ++e+
AM849034_0 282 TLRQIERDLHDGPQQRLVRLRMDLAAAERAL--DTDPERARTLIAEA 326

relarealaevRrllgdLRpaal<-*
e+a+++l+e+R+l +++ p++l
AM849034_0 327 SEHAHDTLEELRALSRGFAPPIL 349

AM849034_0981: domain 1 of 1, from 208 to 276: score 51.4, E = 5.5e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+R++ ++HD+v+Q L+++ + +++ rr l + + ++ +++l++
AM849034_0 208 ERERLSADIHDTVAQDLTGLVMLAQRGRREL--RGGATeAMDQTLAQ 252

irelarealaevRrllgdLRpaal<-*
+++ ar+al+++R+++ + p +l
AM849034_0 253 LEAGARDALTQTRAIVAATAPVEL 276

AM849034_1157: domain 1 of 1, from 176 to 234: score 37.0, E = 9.5e-11
*->RaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeir
Ra +AR+ HD vg+sL++i+ q++ ++ l d++ ++r ++i+
AM849034_1 176 RASMARDVHDIVGHSLAVIIAQADSVQFLD--DEE--RIRGVSATIA 218

elarealaevRrllgd<-*
++ar++laevR++l++
AM849034_1 219 DTARRSLAEVREVLSG 234


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 8 0|=
-13 25 0|====
-12 43 32|===*==
-11 78 269|========== *
-10 274 625|=================================== *
-9 428 710|====================================================== *
-8 388 547|================================================= *
-7 450 344|==========================================*==============
-6 327 194|========================*================
-5 337 104|============*==============================
-4 191 54|======*=================
-3 181 28|===*===================
-2 74 14|=*========
-1 46 7|*=====
0 30 3|*===
1 20 1|*==
2 9 0|==
3 10 0|==
4 8 0|=
5 0 0|
6 1 0|=
7 1 0|=
> 8 14 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2762.8140
P(chi-square) = 0

Total sequences searched: 3057

Whole sequence top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: