Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Xanthomonas campestris pv. campestris str. B100  

Data for AM920689  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: AM920689.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM920689_1208 CDS_1365647-1366657 139.4 2.9e-47 1
AM920689_3911 CDS_4384938-4381306 130.4 3.3e-44 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM920689_1208 1/1 141 223 .. 1 85 [] 139.4 2.9e-47
AM920689_3911 2/2 1014 1097 .. 1 85 [] 129.5 6.9e-44

Alignments of top-scoring domains:
AM920689_1208: domain 1 of 1, from 141 to 223: score 139.4, E = 2.9e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+L +VQS+arQ+l+na+sld+++e++++RL+ALs+aH+
AM920689_1 141 ELNHRVKNSLVMVQSLARQSLKNAESLDDANEKIDARLMALSSAHNT 187

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W +Ad++eL + +++ +++++++R++l+G +
AM920689_1 188 --LTRENWVSADIAELTRDAVELCESHQGQRFELHGSS 223

AM920689_3911: domain 2 of 2, from 1014 to 1097: score 129.5, E = 6.9e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+++vVQS+a+QT ++++++def+++F++RL+ALsr+++L
AM920689_3 1014 ELQHRTRNLITVVQSVATQTMQSSGTMDEFAGKFEDRLAALSRVQGL 1060

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L+++e a+A++++Ll++eL++ g+e+d++Ri l+GPd
AM920689_3 1061 --LSQAENAPATIGALLRMELDALGAEpDQRRIILDGPD 1097


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-17 1 0|=
-16 0 0|
-15 1 0|=
-14 15 0|==
-13 70 0|=====
-12 330 0|========================
-11 459 36|==*==============================
-10 606 461|================================*===========
-9 814 1143|==========================================================*
-8 736 1186|===================================================== *
-7 562 797|========================================= *
-6 324 435|======================== *
-5 219 215|===============*
-4 141 102|=======*===
-3 86 47|===*===
-2 57 21|=*===
-1 18 10|*=
0 9 4|*
1 12 2|*
2 2 0|=
3 2 0|=
> 4 3 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 5407.8408
P(chi-square) = 0

Total sequences searched: 4513

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: