Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Corynebacterium urealyticum DSM 7109  

Data for AM942444  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: AM942444.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
AM942444_0463 CDS_557609-558862 89.9 1.6e-26 1
AM942444_0836 CDS_1001812-1003155 52.1 2.3e-15 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
AM942444_0463 1/1 218 285 .. 1 70 [] 89.9 1.6e-26
AM942444_0836 1/2 190 236 .. 1 47 [. 37.3 5.1e-11

Alignments of top-scoring domains:
AM942444_0463: domain 1 of 1, from 218 to 285: score 89.9, E = 1.6e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD v++sL++++ q+++ r++ +kdpe+a eal++i
AM942444_0 218 ERNRIAREMHDIVAHSLTVVIAQADGGRYAG--RKDPEKAIEALETI 262

relarealaevRrllgdLRpaal<-*
+real+++R ll++L++ +
AM942444_0 263 SVRGREALTQMRSLLSVLHTEEG 285

AM942444_0836: domain 1 of 2, from 190 to 236: score 37.3, E = 5.1e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER R+A ++HD+v+Q+Ls+i + l +++ +l + +++++ ++++
AM942444_0 190 ERMRLAGDIHDTVAQGLSSIHMLLTAVENQL--AGPNPsgTSEARVG 234

ei<-*
ei
AM942444_0 235 EI 236


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-15 1 0|=
-14 3 0|=
-13 19 0|====
-12 37 22|===*===
-11 82 185|============== *
-10 233 430|======================================= *
-9 341 488|========================================================= *
-8 328 376|======================================================= *
-7 270 236|=======================================*=====
-6 205 134|======================*============
-5 239 71|===========*============================
-4 104 37|======*===========
-3 58 19|===*======
-2 39 9|=*=====
-1 24 5|*===
0 18 2|*==
1 12 1|*=
2 5 0|=
3 0 0|
> 4 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 992.2354
P(chi-square) = 0

Total sequences searched: 2024

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: